ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_072290 (PDH E1-beta, PDHE1b)

pyruvate dehydrogenase E1 beta subunit, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite

Who localised this protein by microscopy?

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11013

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0441 pyruvate dehydrogenase E1 beta subunit
  • PBANKA_131010 pyruvate dehydrogenase E1 beta subunit, putative
  • PY07062 pyruvate dehydrogenase E1 beta subunit
  • PVX_118170 pyruvate dehydrogenase E1 beta subunit, putative
  • PCHAS_131330 pyruvate dehydrogenase E1 beta subunit, putative
  • PKH_126000 pyruvate dehydrogenase E1 beta subunit, putative
  • NCLIV_034990 Transketolase, pyridine binding domain protein, related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_072290 pyruvate dehydrogenase E1 beta subunit, putative
MAVLDVPLLFAFHFALALSGVLHLSVSNSTVSARQLSPSFPPTVLPTSRVASLPASAGAPAFVKPSSIHASALSSSFSSP
SSSSSTSPSSPSSSVPQAALYQVGSALDAAASHRPAVQIQEAVVDGEFVNGKSVKEWKVERSLYQALHMALAEELARDPN
VCVMGEDVGHYGGSYKVTKDFHARFGNYRCMDTPICENTFTGMAIGAAMNGLRPVVEGMNMGFLLLAFNQIANNAGMVRY
TSGGAFDVPVVIRGPGGVGKQLGPEHSQRIEAYLMAVPGLKIVACSTPYNARGLLKSAIRENNPVVFFEHVLTYNIKEEI
PLLPYTLPLDKAEVARQGTDITVLAYGKLRHVALDAAQHLEQLGLSAEVVDLISLKPLDMESIQTSIKKTGRCIILDESS
RTGGIGGEIFTQVMENCADDLLEVPVRLATKDIPTPYAAKLEEATIVTPQDVVNSALWLVSKRGPTPTKA

Gene-Specific Links for TGME49_072290

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins