ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_071970 (GAPM3)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex during extracellular tachyzoite

Who localised this protein by microscopy?

Bullen, H. E., Tonkin, C. J., O'Donnell, R. A., Tham, W. H., Papenfuss, A. T., Gould, S., Cowman, A. F., Crabb, B. S., Gilson, P. R.
A novel family of Apicomplexan glideosome-associated proteins with an inner membrane-anchoring role. (2009 Sep 11, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_24492

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_071970 hypothetical protein
MWYSTRQEGFDDPRPSLRGPCVDLPGFLCCGASGNSYFLRGGSLLQVLSLSGLFVSYWTFGGSGLFGYELEGLSEEARAS
HSFQIAMAVWSGLYMIGAAYLVCFQAILADDACWARGYRAGSKILRLATFLDLLSSIMQFIFYLYIAKFYSAKWYAHFLE
GGSERIFFSYIRCMHSVALLLYACAYYLLEVYHDEGAGDLHAYINASLFALAGTVEFFVLFCGLSGLATIFIWLALVAVT
TWAFFFEPEVNEVSPSMHETELTNDVEQQVEKFARMSPYYPAEETGASAPLTAAGSMVMGGMKSQTSMLA

Gene-Specific Links for TGME49_071970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins