ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_071810 ()

inhibitor-1 of protein phosphatase type 2A, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12584

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0257 conserved protein, unknown function
  • PY06840 similar to RIKEN cDNA 2810018A15 gene, putative
  • PVX_085145 hypothetical protein, conserved
  • PCHAS_101750 conserved Plasmodium protein, unknown function
  • PKH_132260 hypothetical protein, conserved in Apicomplexan species
  • TGME49_071810 inhibitor-1 of protein phosphatase type 2A
  • NCLIV_035310 inhibitor-1 of protein phosphatase type 2A, putative
  • cgd1_930 U2 snrnp-specific A' protein
  • Chro.10112 hypothetical protein
  • CMU_035650 leucine rich repeat family protein
  • TP01_0399 hypothetical protein, conserved
  • TA20900 acidic leucine-rich nuclear phosphoprotein 32 family, putative
  • BBOV_IV005960 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_071810 inhibitor-1 of protein phosphatase type 2A
MESAIRERVEHWFAKRGNGEGEEANGAASSASDEEMMKAAGEEMVELILDGRQFKSVSHEASDLLQKLQVLGKFTCNQTG
LHSVEGFPVMPSVKTLELTDNHISGGLEALVKSFPNLKRLQLGGNYFRTFEVLEPLKDLCNLEHLGLDMSPISNQSEYRQ
KVFEMFPRLVVLDSTDKDGKEVEAADSDEEDEEEYDDDEEADTTLKDFYEKDLEDDDEEDEDDFNPDGEEEEDEDFDEEE
EEDRLEGEEACEGAEGELEGKKRKNDAGEDENEAVKHARLGDL

Gene-Specific Links for TGME49_071810

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins