ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_071050 (SAG2, P22)

SRS34A (= SAG2A, P22), a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during after tachyzoite invasion and extracellular tachyzoite and intracellular tachyzoite
vesicle budding off zoite posterior during after tachyzoite invasion

Who localised this protein by microscopy?

Grimwood, J., Smith, J. E.
Toxoplasma gondii: redistribution of tachyzoite surface protein during host cell invasion and intracellular development. (1995, Parasitol Res) PubMed / full text
   more detail about this publication

parasite plasma membrane during after tachyzoite invasion and extracellular tachyzoite and intracellular tachyzoite, vesicle budding off zoite posterior during after tachyzoite invasion
  • "immunoperoxidase detection of the major surface proteins SAG1 and SAG2 revealed that they were distributed uniformly on the surface of extracellular tachyzoites. During invasion of the host cell the majority of the surface label failed to pass throught the tight junction. The label appeared to remain associated with membrane accumulating at the posterior of the zoite, where it was shed in the form of vesicles. This pattern of redistribution was observed with both surface molecules (Figs. 1, 4). However, in some in- stances, shedding of the surface coat was not complete and varying amounts of label were internalised and re- mained on membrane associated with or adjacent to the parasite surface "
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during extracellular tachyzoite, some parasite plasma membrane during intracellular tachyzoite and after tachyzoite invasion, vesicles budding off zoite posterior during after tachyzoite invasion
  • Other genes localised in this publication: SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115207

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_035760 SRS domain-containing protein,SRS34A, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_071050 SRS34A (= SAG2A, P22)
MSFSKTTSLASLALTGLFVVFKFALASTTETPAPIECTAGATKTVEAPSSGSVVFQCGDKLTISPSGEGDVFYGKECTDS
RKLTTVLPGAPAGRNNDGGSSAPTPKDCKLIVRVPGADGRVTSGFDPVSLTGKVLAPGLAGLLITFV

Gene-Specific Links for TGME49_071050

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins