ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_070530 (Ufd1Cy)

ubiquitin fusion degradation domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
cytosol during 24 hours after tachyzoite infection

Who localised this protein by microscopy?

Agrawal, S., van Dooren, G. G., Beatty, W. L., Striepen, B.
Genetic evidence that an endosymbiont-derived endoplasmic reticulum-associated protein degradation (ERAD) system functions in import of apicoplast proteins. (2009 Nov 27, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol during 24 hours after tachyzoite infection

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11043

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0178 ubiquitin fusion degradation protein UFD1, putative
  • PBANKA_102470 ubiquitin fusion degradation protein UFD1, putative
  • PY01641 hypothetical protein
  • PVX_085555 ubiquitin fusion degradation protein, putative
  • PCHAS_102550 ubiquitin fusion degradation protein UFD1, putative
  • NCLIV_036230 Ubiquitin fusion-degradation protein (ISS), related
  • cgd4_1200 ubiquitin fusion degradation protein (UFD1); double Psi beta barrel fold
  • Chro.40141 hypothetical protein
  • CMU_015370 ubiquitin fusion degradation protein 1, putative
  • TP02_0530 hypothetical protein
  • TA13670 ubiquitin fusion degradation protein (UFD1 homologue), putative
  • BBOV_II005920 ubiquitin fusion degradation protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_070530 ubiquitin fusion degradation domain-containing protein
MFSRHVANLLGMGEMDGGPGSGFSQCYSCFPVSFIGKDEMEKGNKILLPQSALHALARLHISWPMLFEVVNEAKDRRTHT
GVLEFVAEEGTCHFPYWMMQNLGLEEGDIVRVRNISLPKGTFVELQPVTTEFLQVSNPRAVLEVALRGYAALTVGDLIYL
PFLDKGFQLLVTDLRPAPAVSIIETDMEVEFKAPEGYVEPTVRAKQSTSEADAAMNSEEESSEIDSAESDSSQRVLFAGK
GTRLDGKAIRASPESAPAKKEEETREPWKNRIKNGVRTKCAEYDELVREGRIPGFIGKVSSGTAGRLPGVSGDAGEGSAN
SRGFAAFFGKGNTCE

Gene-Specific Links for TGME49_070530

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins