ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_070510 ()

asparaginyl-tRNA synthetase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10251

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFB0525w asparagine-tRNA ligase, putative
  • PBANKA_030860 GDP-fructose:GMP antiporter, putative
  • PY02504 asparaginyl-tRNA synthetase
  • PY05639 asparaginyl-tRNA synthetase
  • PVX_002940 asparagine - tRNA ligase, putative
  • PCHAS_031080 GDP-fructose:GMP antiporter, putative
  • PKH_040840 asparagine-tRNA ligase, putative
  • TGME49_070510 asparaginyl-tRNA synthetase, putative
  • TGME49_102750 OB-fold nucleic acid binding domain-containing protein
  • NCLIV_036250 Asparaginyl-tRNA synthetase, related
  • cgd8_350 asparaginyl-tRNA synthetase (NOB+tRNA synthase)
  • Chro.80047 asparaginyl-tRNA synthetase
  • CMU_024270 asparaginyl-tRNA synthetase family protein
  • TP01_0818 asparaginyl-tRNA synthetase, putative
  • TP02_0746 asparaginyl-tRNA synthetase, putative
  • TA05825 asparaginyl-tRNA synthetase (chloroplast/mitochondrial precursor), putative
  • TA14880 asparaginyl-trna synthetase, putative
  • BBOV_III011270 asparaginyl-tRNA synthetase family protein
  • BBOV_IV009530 asparaginyl-tRNA synthetase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_070510 asparaginyl-tRNA synthetase, putative
MPRRCWQLFVCCSVREFPVSVASRLLLPLLFVLASARNSALLYSSALTLRSSAAPLAFSSAGCRFRGPLHRPWFPVRLTP
PDQAYLSRNSASGTSPRSIRQFPVPSGLALPTSVPLCARTLPPLSRHFASVGTMAQPQGESKSFTPGHLEDQVPTSCKQA
IPVFGCGSTRVRLAALLDGGEASVEKFVNRETPVTVCGWSRSVRKQGGGSLCFVVLSDGSTSSNLQVVVEAGIGGEFPQL
LKCGAGCSFRFTGDIVKSPAKGQAVELAVRDPSKGHRFEILGMTDAAKYPLAKKEHTREYLREIAHLRPRSYLIGAVMRV
RSNLAMATHRFFQDRGFLYIHTPIVTASDCEGAGEMFQVSTLLPPPPPETRENEKKTDGAAPKDAAAAAAEPLIPLTKDK
KGVDYSRDFFGRPAFLTVSGQLAVEPYCCSLSDVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFATLEDNMVVAEAYVKF
CVQWVLDNCRADIEWFQKNQEEGLIARLENILAEPFARVSYTEAIEVLKAEEPKAQFKEKVEWGMDMGSEHERYLTENVY
KKPCIVYNYPKDIKAFYMKLNEDGKTVRAMDVLVPKIGELVGGSQREDDRDRLAAMIAAKDLDPKPYWWYMELREYGTIP
HAGFGLGFERLVMLVTGIENIRDTIPYPRYPGHAEF

Gene-Specific Links for TGME49_070510

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins