ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_070380 (RPS13)

40S ribosomal protein S13, putative, a gene from Toxoplasma gondii

Compiled localisation
perinuclear area of endoplasmic reticulum and perinuclear area of golgi during intracellular tachyzoite

Who localised this protein by microscopy?

Hutson, S. L., Mui, E., Kinsley, K., Witola, W. H., Behnke, M. S., El Bissati, K., Muench, S. P., Rohrman, B., Liu, S. R., Wollmann, R., Ogata, Y., Sarkeshik, A., Yates, J. R. 3rd, McLeod, R.
T. gondii RP promoters & knockdown reveal molecular pathways associated with proliferation and cell-cycle arrest. (2010, PLoS One) PubMed / full text
   more detail about this publication

perinuclear area of endoplasmic reticulum and perinuclear area of golgi during intracellular tachyzoite
  • "RPS13 and RPL22 were in the perinuclear area of endoplasmic reticulum and golgi (Figure 4D)."
  • Microscopy type: fixed light
  • Microscopy method: antibody to rabbit homologue
  • Strain: RH HXGPRT-
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: perinuclear area of endoplasmic reticulum and perinuclear area of golgi during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10562

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_070380 40S ribosomal protein S13, putative
MGRMYGPGKGMSASALPWRRKPPTWLKIKPSDVEEHIAKLAKKGQTPSQIGVTLRDSFGVPQVKSVTGNKILRILKLQGL
APELPEDLYYLIKKAVSVRKHLERNRKDKDAKFRLILVESRIHRLARYYKRTKQLPATWKYQSATASALVA

Gene-Specific Links for TGME49_070380

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins