ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_070250 (GRA1)

dense granule protein 1 / major antigenp24, a gene from Toxoplasma gondii

Compiled localisation
dense granule during bradyzoite and sporozoite and tachyzoite
not parasitophorous vacuole during bradyzoite and merozoite and sporozoite parasitophorous vacuole 1 and sporozoite
during not merozoite
parasitophorous vacuole during bradyzoite and tachyzoite
oocyst wall during bradyzoite and tachyzoite
not evacuole during tachyzoite invasion

Who localised this protein by microscopy?

Gordon, J. L., Beatty, W. L., Sibley, L. D.
A novel actin-related protein is associated with daughter cell formation in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

dense granule

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during bradyzoite and tachyzoite, oocyst wall during bradyzoite, during not merozoite

Hakansson, S., Charron, A. J., Sibley, L. D.
Toxoplasma evacuoles: a two-step process of secretion and fusion forms the parasitophorous vacuole. (2001 Jun 15, EMBO J) PubMed / full text
   more detail about this publication

not evacuole during tachyzoite invasion
  • "Approximately 67% of cell-associated parasites produced ROP2-positive and GRA1-negative vesicles within the host cell cytosol, beneath the point of attachment."
  • Microscopy type: Light
  • Microscopy method:
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not evacuole during tachyzoite invasion
  • Comment: localisation method not discussed
  • Other genes localised in this publication: rhoptry protein, putative, Rhoptry kinase family protein ROP2A (incomplete catalytic triad)

Ferguson, D. J., Cesbron-Delauw, M. F., Dubremetz, J. F., Sibley, L. D., Joiner, K. A., Wright, S.
The expression and distribution of dense granule proteins in the enteric (Coccidian) forms of Toxoplasma gondii in the small intestine of the cat. (1999 Mar, Exp Parasitol) PubMed / full text
   more detail about this publication

during not merozoite, dense granule during bradyzoite and sporozoite and tachyzoite, oocyst wall and parasitophorous vacuole during tachyzoite, not parasitophorous vacuole during bradyzoite and merozoite and sporozoite

Tilley, M., Fichera, M. E., Jerome, M. E., Roos, D. S., White, M. W.
Toxoplasma gondii sporozoites form a transient parasitophorous vacuole that is impermeable and contains only a subset of dense-granule proteins. (1997 Nov, Infect Immun) PubMed / full text
   more detail about this publication

not parasitophorous vacuole during sporozoite parasitophorous vacuole 1
  • "While sporozoites inhabited the distinctive PV1, the staining of anti-GRA1, -GRA2, and -GRA4 antibodies was confined to dense granules within the sporozoite cytoplasm and no staining was observed outside of the parasite itself"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: VEG
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not PV during sporozoite parasitophorous vacuole 1
  • Other genes localised in this publication: 28 kDa antigen, hypothetical protein, dense granule protein 5 precursor, nucleoside-triphosphatase I

Achbarou, A., Mercereau-Puijalon, O., Sadak, A., Fortier, B., Leriche, M. A., Camus, D., Dubremetz, J. F.
Differential targeting of dense granule proteins in the parasitophorous vacuole of Toxoplasma gondii. (1991 Dec, Parasitology) PubMed / full text
   more detail about this publication

dense granule during tachyzoite
  • "All four proteins were found in dense granules by immunoelectron microscopy; in T. gondii-infected cells, they were found in the vacuolar network but, in addition, GRA 3 was also detected on the parasitophorous vacuole membrane."
  • Microscopy type: EM
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from orthologue AY223805, annotation matches
  • Localisation record: dense granule during tachyzoite
  • Comment: Couldn't find Full Text – strain not recorded in abstract
  • Other genes localised in this publication: 28 kDa antigen, dense granule protein 3, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115230

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_070250 dense granule protein 1 / major antigenp24
MVRVSAIVGAAASVFVCLSAGAYAAEGGDNQSSAVSDRASLLGLLSGGTGQGLGIGESVELEMMGNTYRVERPTGNPDLL
KIAIKTSDGSYSEVGNVNMEEVIDTMKSMQRDEEIFFRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQD
EMNVIDDVQQLEKDKQQLKDDIGFLTGERE

Gene-Specific Links for TGME49_070250

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins