ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_070240 (MAG1, 65 kDa)

cyst matrix protein, a gene from Toxoplasma gondii

Compiled localisation
not parasitophorous vacuole and parasitophorous vacuole during intracellular tachyzoite
cyst matrix and oocyst wall during bradyzoite
during not tachyzoite

Who localised this protein by microscopy?

Ferguson, D. J., Parmley, S. F.
Toxoplasma gondii MAG1 protein expression. (2002 Nov, Trends Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during intracellular tachyzoite
  • "However, when developing intracellular tachyzoites were examined, the parasitophorous vacuoles also exhibited some focal staining for MAG1 (Fig. 1b)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RRA, RH, NTE, M3
  • Gene model mapping comments: blast from U09029, annotation matches
  • Localisation record: PV during intracellular tachyzoite
  • Other genes localised in this publication: -

Parmley, S. F., Yang, S., Harth, G., Sibley, L. D., Sucharczuk, A., Remington, J. S.
Molecular characterization of a 65-kilodalton Toxoplasma gondii antigen expressed abundantly in the matrix of tissue cysts. (1994 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cyst matrix and oocyst wall during bradyzoite, during not tachyzoite, not parasitophorous vacuole during intracellular tachyzoite
  • ""
  • Microscopy type:
  • Microscopy method:
  • Strain:
  • Gene model mapping comments: blast from U09029, annotation matches
  • Localisation record: cyst wall and cyst matrix during bradyzoite, not during tachyzoite, not PV during intracellular tachyzoite
  • Comment: no fulltext available online
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115231

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_070240 cyst matrix protein
MDCGQCRRQLHAAGVLGLFVTLATATVGLSQRVPELPEVESFDEVGTGARRSGSIATLLPQDAVLYENSEDVAVPSDSAS
TPSYFHVESPSASVEAATGAVGEVVPDCEEQQEQGDTTLSDHDFHSGGTEQEGLPETEVAHQHETEEQYGTEGMPPPVLP
PAPVVHPRFIAVPGPSVPVPFFSLPDIHPDQVVYILRVQGSGDFDISFEVGRAVKQLEAIKKAYREATGKLEADELESER
GPAVSPRRRLVDLIKDNQRRLRAALQKIKIQKKLEEIDDLLQLTRALKAMDARLRACQDMAPIEEALCHKTKAFGEMVSQ
KAKEIREKAASLSSLLGVDAVEKQLRRVEPEHEDNTRVEARVEELQKALEKAASEAKQLVGTAAGEIEEGVKADTQAVQD
SSKDVLTKSQLALVEAFKAIQRALLEAKTKELVEPTSKEAEEARQILAEQAA

Gene-Specific Links for TGME49_070240

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins