ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_069840 ()

26S proteasome non-ATPase subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11204

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.343 proteasome regulatory subunit, putative
  • PBANKA_114400 proteasome regulatory subunit, putative
  • PY03078 Mov34/MPN/PAD-1 family, putative
  • PVX_115365 26S proteasome regulatory subunit rpn11, putative
  • PCHAS_114350 proteasome regulatory subunit, putative
  • PKH_110240 proteasome regulatory subunit, putative
  • TGME49_069840 26S proteasome non-ATPase subunit, putative
  • NCLIV_036720 CBR-CSN-5 protein, related
  • cgd6_3270 26S proteasome-associated Mov34/MPN/PAD-1 family. JAB domain.
  • Chro.60380 Mov34/MPN/PAD-1 family proteasome regulatory subunit
  • CMU_031340 Mov34/MPN/PAD-1 family proteasome regulatory subunit, putative
  • TP02_0201 proteasome regulatory subunit, putative
  • TA11850 proteasome regulatory subunit, putative
  • BBOV_II007480 26S proteasome regulatory subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_069840 26S proteasome non-ATPase subunit, putative
MAGLPSNLRGLLQQFGGMGVGPPNRDQPMADTSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFIDDYTVRVVDVFSM
PQSGNSVSVEAVDPVYQTEMLEQLKRTGRPEMVVGWYHSHPGFGCWFSGTDVNTQQSFEQLNPRAVGVVVDPIQSVKGKV
VIDCFRLINPHLLMLGQELRQTTSNIGHLQRPTISALVHGLNRNYYAIVINYRKNELENQMLLNLHRNKWNDALKLKPFD
EMAAESAACTKSMKELSEQYNKMVQEEIKKTPEQLVVERAGKVDAKKRLENDVDTLMTENILHSLGTMIDTLVF

Gene-Specific Links for TGME49_069840

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins