ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_069250 ()

26S proteasome regulatory subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11424

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0630w 26S proteasome regulatory subunit, putative
  • PBANKA_081390 26S proteasome regulatory subunit, putative
  • PY05051 probable 26s proteasome regulatory subunit s12
  • PVX_099080 26S proteasome regulatory subunit, putative
  • PCHAS_081420 26S proteasome regulatory subunit, putative
  • PKH_071020 26S proteasome regulatory subunit, putative
  • TGME49_069250 26S proteasome regulatory subunit, putative
  • NCLIV_037150 hypothetical protein
  • cgd7_2900 26S proteasome regulatory subunit, inactive JAB domain protein
  • Chro.70327 26S proteasome regulatory particle non-ATPase subunit8
  • CMU_022870 Mov34/MPN/PAD-1 family protein
  • TA07380 26S proteasome (regulatory) subunit, putative
  • BBOV_II003480 26S proteasome regulatory particle non-ATPase subunit8, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_069250 26S proteasome regulatory subunit, putative
MSENSSKTAAAASGEPQLDSLSSFASVAGLVASKTVVVHPIVLLSVVDHYNRVARGTSRRVVGTLLGEISDGEIHVTNSF
ALPFEEDPKDPNVWYLDRNYHEHLYHMFKKVNTRERVLGWYSTGPQVRMTDLEIHEIFRRYTPNPVYVIVDINPKDSVVP
TKAYYSFEQPTSDRTFRRTFVHVASTIGALEAEEVGVEHLLRDLKNASTSTLATRVADKLSALKLLIGKIQEIYAYLQDA
ANKKIVANPNIMYTIQDIFNLLPDLSDPELIEAFTIQANDTMLNLYLGSVVRSVLALHNLINNKVENKRASEEKKEKKED
EETGETKKEAGTDTKKGEKESSQ

Gene-Specific Links for TGME49_069250

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins