ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_069190 (GAPDH2)

glyceraldehyde-3-phosphate dehydrogenase, a gene from Toxoplasma gondii

Compiled localisation
endoplasmic reticulum during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10093

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_132640 glyceraldehyde-3-phosphate dehydrogenase, putative
  • PY03280 glyceraldehyde-3-phosphate dehydrogenase
  • PCHAS_132970 glyceraldehyde-3-phosphate dehydrogenase, putative
  • PKH_124290 glyceraldehyde-3-phosphate dehydrogenase, putative
  • NCLIV_037190 glyceraldehyde-3-phosphate dehydrogenase, putative
  • NCLIV_041940 Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12), related
  • cgd6_3790 glyceraldehyde 3-phosphate dehydrogenase
  • Chro.60434 glyceraldehyde-3-phosphate dehydrogenase
  • CMU_017050 glyceraldehyde-3-phosphate dehydrogenase, type I family protein
  • TP02_0858 glyceraldehyde-3-phosphate dehydrogenase, putative
  • TA08145 glyceraldehyde-3-phosphate dehydrogenase, putative
  • TA15530 glyceraldehyde 3-phosphate dehydrogenase, putative
  • BBOV_II002540 glyceraldehyde-3-phosphate dehydrogenase protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_069190 glyceraldehyde-3-phosphate dehydrogenase
MAAVTEGEIEAVALDLLQESGVDGPAVLEHMARDGRGSASDLCSLVQTLATELLQTERDPRCAAAPTSEDRENIALTTEA
LLTSAFGFLGPASPSATAATAATVASGTPQNARSASIRSHRRNSFAPTGKRAVAPVPRVSPTGLFGLLGSSSEKASAPIR
LGINGMGRIGRLVFRIAMSRPDVAVTHINCSMDPAYIAYMLKYDSVHGKFDGEIVPTETSLIVNGQEVTVSNTRDPEEIP
WADKGADYVCESTGVFCTTEAAAKHVNRPGGAKHAIISAPAKDETTPTLVVGVNAEQDYESSMKVVSCASCTTNGLAPLV
KVIDENFGLVEGLMTTVHAATGTQKVVDGTSKKDWRGGRAAAGNIIPSATGAAKAVARCLPHMKGKLTGMAFRVPTLDVS
VVDLTCRLNKSTTYEEIKKAVREASETYMRGIIGYTEEPIVSQDIVGSQCSTVFDANAGIMLNPNFVKLVSWYDNEYAYS
ARLVDLIAVMAAKDGVVSPGTGLDRRPF

Gene-Specific Links for TGME49_069190

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins