ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_068950 ()

la domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_36812

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • TGME49_068950 la domain-containing protein
  • NCLIV_037400 la domain-containing protein, putative
  • cgd8_3220 La domain fused to two RRMs (as in the La autoantigen) which is further fused to a C-terminal domain present in the plant DCL protein and the C-terminus of the alpha subunit of the plant RNA polymeras
  • Chro.80374 RNA-binding protein
  • CMU_023760 La domain-containing protein
  • TA13225 hypothetical protein
  • BBOV_III005060 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_068950 la domain-containing protein
MATPEANAAAAAAPVEQNAVGSADQGKDSQPEMTPEKHEGKNVCNEEKELSRKRKRGGHEDSFFPKKREEMTPEQLKQRI
KRQVEYYLSDESLAYDAFFQSKMREAAQQGKGESLDLRFVLSSPRIKSLNLTKAEILAAIADSVAVKVKEEADGTTLLYR
ETPLPELQERPQRTACARREDGSGGASRLPQGVGRDPHAAGVFLKLCDIPESVQQWQQVKDAIKETLPGEVFVKFVSKIE
EVSVSADKKTRRCWVYLGSFEDDRETLQKMQPIKIPLGDGEAEAYILTDQEVRLCVQDLPPRIRTAREKDLQTLRRQLAA
LPLSLGGIPFKSVEHLRMCMAEFLQKTPVDQALKPNSAAEKAVKGLLDYHPKAYIKKGGRDREVVGIKVGLHDKRDSQSG
ERSKCFFVVRKKKGAEEDEEDVEDFSVSKCISELAKDPPCEAEELNKLLRKRYESVAQQRAHAAEQAQKRRKIREEAARV
TGAATAVAESSETSEKDEKQGAESNKNNDGPVAEPAATAPKEGQTAAEDSAQIAEAKVESQTA

Gene-Specific Links for TGME49_068950

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins