ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_068900 (GRA10) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

dense granular protein GRA10, a gene from Toxoplasma gondii

Compiled localisation
dense granule during tachyzoite
parasitophorous vacuole during shortly after invasion of tachyzoite

Who localised this protein by microscopy?

Ahn, H. J., Kim, S., Nam, H. W.
Host cell binding of GRA10, a novel, constitutively secreted dense granular protein from Toxoplasma gondii. (2005 Jun 3, Biochem Biophys Res Commun) PubMed / full text
   more detail about this publication

dense granule during tachyzoite, parasitophorous vacuole during shortly after invasion of tachyzoite
  • "Monoclonal antibodies (mAbs) against Toxoplasma gondii, Tg378 and Tg556 clones, are specifically observed to localize to the dense granules of tachyzoites by immunofluorescence microscopy. mAb Tg556 is directed against GRA3, a previously described 30 kDa dense granular protein. mAb Tg378 is directed against a novel 36 kDa dense granular protein, which we refer to as GRA10. These are major proteins in the excretory/secretory proteins from T. gondii before the parasite’s entry into host cells, and they are released into the parasitophorous vacuole (PV) during or shortly after invasion to be associated with the PV membrane."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AY769952, gene model inconsistent
  • Localisation record: dense granule during tachyzoite, PV during shortly after tachyzoite invasion
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115276

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_068900 dense granular protein GRA10
MMLLYYRLSSEHAGSYRQCPLSCSALSLAEVKQLLAARCGLANEYGRKIDFRIFLAGSQVPGGAAEAEELTEIVDENQMI
HAYSKVVLQRVAITYGGSGQSVLHKARSELSQEEWKTAEERKLSSRLKRLPPEWLCGLCHRVMTNPVLVRCATNCAQSAC
HACLEAHLGPNRICPFCNSPFRQAIRNKRLQEIIALANLSEFESAPGAACAVPQLQVQAYQAGDPASSAVAPGEGSRSTD
LIRSACREGPSDASRLGSGESHSATGAGVADRVSGGNVCEDRETDDDVGADGSRGDSAGASDSFRSEADWVHFVYLVPQE
NLKLMRQYDMMVVESSSNLAVALVRKATQRGGSGNPDAAAELGEPAEGALRDGTGNSGPTTATGETEQQEQVRTTGSKNT
DHEVFVVPLCSAGGGTSFSIAGFARINSARQVDPEADSAAATVVQQWQSSSGRASNLPGHGAGLAFGVYRISWDNKFNPM
PMLPSRKQPLCSLLGAHRRQFHSNASGVPAVPGLLKREVFGGAGAGMIEAAVEAAKYEEVLACIKDYAQFGSRPAEPWQH
PASQTSSAAAATPGLPKKGVPVGGIGQEGSRVPPPPPPPPGSVGESGFSLSSGNGVSVVEKRDVSSEGRGPSDGVSISFN
ARGASLPGSLGDERKALETGVFGIPVSLGPPSLGLRGDPGEPSNPYLGYCALLPLLTEEQFRHIRRLQKRAMVLCGYTQS
PPESRKKRRRSGKKKRGKHSVSSHSTGSGTLPSDEPVDGCDRVREEAEKEGTGCMSADAPAVDTNTEALSIQNAATSVTR
QPLSDPDSANATGSRVRAGRRALPRVPPVLKISRIGDKNDTDTTQNKDTGSMQSQRANSVIETCSVVEENTMAKIPGAEA
KPEGVPDNGPCELP

Gene-Specific Links for TGME49_068900

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins