ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_068890 (CS1, Citrate-synthase I (CS1))

citrate synthase, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Fleige, T., Pfaff, N., Gross, U., Bohne, W.
Localisation of gluconeogenesis and tricarboxylic acid (TCA)-cycle enzymes and first functional analysis of the TCA cycle in Toxoplasma gondii. (2008 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11071

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_050670 citrate synthase, mitochondrial precursor, putative
  • PY01660 probable citrate synthase, mitochondrial precursor
  • PVX_111595 citrate synthase, mitochondrial precursor, putative
  • PVX_228290 citrate synthase, mitochondrial precursor, putative
  • PCHAS_050680 citrate synthase, mitochondrial precursor, putative
  • PKH_060660 citrate synthase, mitochondrial precursor, putative
  • NCLIV_037460 hypothetical protein
  • TP02_0666 citrate synthase, putative
  • TA14450 citrate synthase, mitochondrial precursor, putative
  • BBOV_II006920 citrate synthase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_068890 citrate synthase, putative
MLLSRLRDTAAAALVLRTSGSTALSPPSFLYPASLVRPTSGKAPSLLAATHTSPFSAPVCAAVQSKRLLGRSQSLFRKNT
ASALRSFSSSARSVCGGLSNAEARAAVEAALDALAEKVQEAAEPKRELLKTLRKEHGTVVISEATLSTVCGGMRGLTAIL
TETSTLHAEKGILYRGLTINECLAKLPRMHKEEYPAVEGLIWFLMTGSIPTVNEVELLSNALYALSLSSASSSPSAPFIP
PHVGKVLDAVPPSTHPMTQLVMAAAALQPTSELAQAYRHKTVSRHDLWKPALADALSLIAKNAVMAARIFRRSFRDGQEI
DPVRSLDWAANFGHMMGFNSKEHQELFRLYLFLHADHEGGNVSAHAAHVVGSALSDPFLAFSAGMAGLAGPLHGLANQEC
LNWLRDVHCKLNGAAPTRENVKKIAEDTLASGRVIPGYGHAVLRVTDPRFTAQREFALKYLKDDELFQLLNVAYNTIPDV
LLATGKVKNPYPNVDCHSGVLLQHFGITEADFYTVLFGVSRAIGIACQYVWDRILGLPIERPKSTTLDLLKAACVERKGN

Gene-Specific Links for TGME49_068890

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins