ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_068860 (ENO1)

enolase 1, a gene from Toxoplasma gondii

Compiled localisation
cytosol during intracellular tachyzoite
nucleus during intracellular bradyzoite and intracellular tachyzoite
cytoplasm and not parasite plasma membrane during intracellular bradyzoite
during bradyzoite and not enteric and not merozoite and not tachyzoite

Who localised this protein by microscopy?

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol and nucleus during intracellular tachyzoite

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

during bradyzoite and not merozoite and not tachyzoite

Ferguson, D. J., Parmley, S. F., Tomavo, S.
Evidence for nuclear localisation of two stage-specific isoenzymes of enolase in Toxoplasma gondii correlates with active parasite replication. (2002 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and nucleus and not parasite plasma membrane during intracellular bradyzoite, during not enteric and not tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10159

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_068860 enolase 1
MVVIKDIVAREILDSRGNPTIEVDVSTEGGVFRAAVPSGASTGIYEALELRDKDPKRYLGKGVLNAVEIVRQEIKPALLG
KDPCDQKGIDMLMVEQLDGTKNEWGYSKSKLGANAILGVSIACCRAGAASKGLPLYKYIATLAGKTIDKMVMPVPFFNVI
NGGEHAGNGLALQEFLIAPVGAPNIREAIRYGSETYHHLKNVIKNKYGLDATNVGDEGGFAPNVATAEEALNLLVEAIKA
AGYEGKIKIAFDAAASEFYKQDEKKYDLDYKCKTKNASKHLTGEKLKEVYEGWLKKYPIISVEDPFDQDDFASFSAFTKD
VGEKTQVIGDDILVTNILRIEKALKDKACNCLLLKVNQIGSVTEAIEACLLAQKSGWGVQVSHRSGETEDSFIADLVVGL
RCGQIKSGSPCRSERLCKYNQLMRIEESLGADCVYAGESFRHPK

Gene-Specific Links for TGME49_068860

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins