ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_068850 (ENO2)

enolase 2, a gene from Toxoplasma gondii

Compiled localisation
cytosol and not nucleolus during intracellular tachyzoite
nucleus during early- to mid- stage schizont and intracellular tachyzoite and late multinucleate tachyzoite and merozoite and microgamete and schizont and tachyzoite and trophozoite
cytoplasm during intracellular tachyzoite and macrogametocyte and merozoite and microgamete and schizont and tachyzoite
not parasite plasma membrane during intracellular tachyzoite and microgamete and schizont
during macrogamete and not bradyzoite

Who localised this protein by microscopy?

Olguin-Lamas, A., Madec, E., Hovasse, A., Werkmeister, E., Callebaut, I., Slomianny, C., Delhaye, S., Mouveaux, T., Schaeffer-Reiss, C., Van Dorsselaer, A., Tomavo, S.
A novel Toxoplasma gondii nuclear factor TgNF3 is a dynamic chromatin-associated component, modulator of nucleolar architecture and parasite virulence. (2011 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

nucleus and not nucleolus during intracellular tachyzoite

Ferguson, D. J., Sahoo, N., Pinches, R. A., Bumstead, J. M., Tomley, F. M., Gubbels, M. J.
MORN1 has a conserved role in asexual and sexual development across the apicomplexa. (2008 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

nucleus during late multinucleate tachyzoite

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol and nucleus during intracellular tachyzoite

Ferguson, D. J., Henriquez, F. L., Kirisits, M. J., Muench, S. P., Prigge, S. T., Rice, D. W., Roberts, C. W., McLeod, R. L.
Maternal inheritance and stage-specific variation of the apicoplast in Toxoplasma gondii during development in the intermediate and definitive host. (2005 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytoplasm during macrogametocyte, nucleus during early- to mid- stage schizont and trophozoite
  • "These staining combinations assisted in the identification of the various developmental stages, with the ENO2 strongly labeling the active nuclei of the trophozoites and early- to mid-stage schizonts and also the cytoplasm of the macrogametocyte and with the anti-NTPase localizing to the parasitophorous vacuole and the dense granules within mature merozoites (10, 14)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during macrogametocyte, strongly nucleus during trophozoite and early- to mid- stage schizont
  • Comment: strain information ambiguous
  • Other genes localised in this publication: enoyl-acyl carrier reductase, SRS29B (= SAG1, P30), bradyzoite antigen, putative, nucleoside-triphosphatase I

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during merozoite and tachyzoite, during not bradyzoite

Ferguson, D. J., Parmley, S. F., Tomavo, S.
Evidence for nuclear localisation of two stage-specific isoenzymes of enolase in Toxoplasma gondii correlates with active parasite replication. (2002 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during intracellular tachyzoite and merozoite and microgamete and schizont, not parasite plasma membrane during intracellular tachyzoite and microgamete and schizont, during macrogamete and not bradyzoite
  • "Table 1."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RRA, NTE, M3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nucleus and weak cytoplasm and not membrane during intracellular tachyzoite and microgamete and schizont, variable during macrogamete, cytoplasm and weak nucleus during merozoite, not during bradyzoite
  • Other genes localised in this publication: enolase 1, lactate dehydrogenase, lactate dehydrogenase, SRS29B (= SAG1, P30), bradyzoite antigen, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10159

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_068850 enolase 2
MFRLLVPTYYSYSVPLRFPFCKIYRYSTSNKMVAIKDITARQILDSRGNPTVEVDLLTDGGCFRAAVPSGASTGIYEALE
LRDKDQTKFMGKGVMKAVENIHKIIKPALIGKDPCDQKGIDKLMVEELDGTKNEWGWCKSKLGANAILAVSMACCRAGAA
AKGMPLYKYIATLAGNPTDKMVMPVPFFNVINGGSHAGNKVAMQEFMIAPVGASTIQEAIQIGAEVYQHLKVVIKKKYGL
DATNVGDEGGFAPNISGATEALDLLMEAIKVSGHEGKVKIAADVAASEFFLQDDKVYDLDFKTPNNDKSQRKTGEELRNL
YKDLCQKYPFVSIEDPFDQDDFHSYAQLTNEVGEKVQIVGDDLLVTNPTRIEKAVQEKACNGLLLKVNQIGTVSESIEAC
QLAQKNKWGVMVSHRSGETEDSFIADLVVGLRTGQIKTGAPCRSERLCKYNQLMRIEESLGSDCQYAGAGFRHPN

Gene-Specific Links for TGME49_068850

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins