ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_068590 (ROM4) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

rhomboid-like protease 4, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during extracellular tachyzoite and intracellular tachyzoite and tachyzoite
not inner membrane complex during extracellular tachyzoite and intracellular tachyzoite
cytoplasmic structure and residual body during after tachyzoite division

Who localised this protein by microscopy?

Sheiner, L., Dowse, T. J., Soldati-Favre, D.
Identification of trafficking determinants for polytopic rhomboid proteases in Toxoplasma gondii. (2008 May, Traffic) PubMed / full text
   more detail about this publication

parasite plasma membrane and not inner membrane complex during extracellular tachyzoite and intracellular tachyzoite
  • "These observations confirmed that TgROM4 localizes to the PM and validated the topology prediction."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein, Ty tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PM and not IMC during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: rhomboid-like protease TgROM2, rhomboid family domain-containing protein, microneme protein MIC4

Brossier, F., Jewett, T. J., Sibley, L. D., Urban, S.
A spatially localized rhomboid protease cleaves cell surface adhesins essential for invasion by Toxoplasma. (2005 Mar 15, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

parasite plasma membrane during extracellular tachyzoite and intracellular tachyzoite
  • "(B) TgROM4 (aHA9) was uniformly distributed at the surface of intracellular (Upper) and on extracellular parasites (Lower)"
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: Blast from AY704175.1, gene model inconsistent
  • Localisation record: uniform surface during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: rhomboid family domain-containing protein, rhomboid-like protease 5, microneme protein 2

Dowse, T. J., Pascall, J. C., Brown, K. D., Soldati, D.
Apicomplexan rhomboids have a potential role in microneme protein cleavage during host cell invasion. (2005 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite, cytoplasmic structure and residual body during after tachyzoite division
  • "(D) Peripheral localisation of TgROM5 at the plasma membrane and in undefined intracellular structures and residual bodies sometimes produced after parasite division; a-myc in green, a-MIC4 or a-GAP45 in red."
  • Microscopy type: Light
  • Microscopy method: N-terminal myc tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: plasma membrane during tachyzoite, sometimes cytoplasmic structures and residual bodies during after tachyzoite division
  • Other genes localised in this publication: membrane skeletal protein IMC1, rhomboid family domain-containing protein, microneme protein MIC4, rhomboid-like protease TgROM2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_17769

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_068590 rhomboid-like protease 4
MHEASEGEIYFPVLVLTLRVVLVQVWTSAVVMASPHGSASRAGSNRRTDGLSVNLGQDNTLKHDTPTETAPSASPPRVAP
APIPPKGGPAATPGKDGALDNRGSHDSVPPVAVAIPGREEVNATASQKSVVAGANSQPTPGTQSSKAPASDVDGSSKHGS
PEHPDAGSPEVNAEGVPVEEALQAIGDDDPLIHNLPDGVVGRRAPANPFNSPMYAKLRGKKKKHRPKVRDPKLNNNPLRG
RLVVCISTTALLCWIYMWELIYNFTSFNGRCVSPVMYPDYKLQEAKQRQPYVIRYGYGGCEYNLGSLAYPRASFGTSAGD
KGWPVDLVPNGSAGSAATSWDSPNARVLRHLGGLETNYIREYSETFRLFTSMYMHGGWLHILINLSCQIQILWIIEPDWG
FLRTTLLFFLGGISGNLLSAVADPCSITVGSSGSMYALLGALIPYCVEYWKSIPRPGCILVFMIVVIIGILTGMAGFTDN
YAHMGGALGGILWGFASITTVSACDKCTLGERMAMTPPFSWCVPKATQQKLLERAKARKAEAIRRRKLQAIQKKKAGGAR
GKAMYAVKMRLQEEGRPPCKMSFREWVIRGLCAAALFAYWLILFLYLLDPSLYKSYSPPGQLKFSGWLYCKCGTIVYQAP
QTYGNLGRFWCFGSEKDAQYYLEP

Gene-Specific Links for TGME49_068590

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins