ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_067800 (DrpA)

dynamin-like protein, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast periphery and mitochondrion and not golgi apparatus

Who localised this protein by microscopy?

van Dooren, G. G., Reiff, S. B., Tomova, C., Meissner, M., Humbel, B. M., Striepen, B.
A novel dynamin-related protein has been recruited for apicoplast fission in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

apicoplast periphery and mitochondrion and not golgi apparatus

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10138

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_067800 dynamin-like protein, putative
MEELIPVVNRLQDVLASLGASASGPVLDLPQIAVVGAQSVGKSSVLEALVGRSFLPRGTGIVTRRPLILQASSLFSPPPL
PPQKPPSLSSPSLPLSPIDLQEEFGEFLHCPSRKFTDFEEIRREIERETERVGGQKNISPSPIVLKVSSPHVIDLTLVDL
PGITKVPVGDQPSDIEAQIRRIVFQFISEPSTIILAVTAANTDIANSDSLKIAREVDPEGLRTVGVVTKVDTLEEGADCS
EVLRNRVIPLKRGYVGVVCRGQRQAAEMSIRDGLKEEESFFRSHPAYRAIASKQGIPFLAKMLNQILMKHIREALPELRS
RISRLLQKTEAELATYGDPLLEAKANPGALLLHFFSRFARNFQDAIEGKLQAHHSSEQLMGGARINFIFHDWYSRALAEF
DPLEGLSDHEIRTAIRNATGPKAALFVPEGAFEILVRRQIQQLETPSLQCVEQVYEELQKIVAKCELPEMARFSNLRERV
MDVVRGVLRRCLAPTNQMIHNIIQIELAYINTNHPDFMNNRFGPSSRESAALTAHPRRSSAEKNGPPSGSHSRGSSGVGS
SLFASDGSTTSSGSGPPPSPLLTPPPLLSQANQVAAAAAAAAGESPSEQITSAGMLNQGGFFAFLKGARPSASSFFPSAS
PTSSKEFSEQSLPASVDAAASALSSQRPGHSSADGETNRAFFGGSFAGSALDRVRACRISLPQVPSIVAPSEVPSEREQI
ETDLIKSLIWSYFQIVRKNVSDAVPKSIMYFMVNTAKDVLQRELVAQLYREELFGELMKEADDVAERRMQCKQLLRSLRA
AGDVLSHIRDFSLSDGTSFASACR

Gene-Specific Links for TGME49_067800

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins