ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_067680 (MIC12)

microneme protein, putative, a gene from Toxoplasma gondii

Compiled localisation
microneme

Who localised this protein by microscopy?

Opitz, C., Di Cristina, M., Reiss, M., Ruppert, T., Crisanti, A., Soldati, D.
Intramembrane cleavage of microneme proteins at the surface of the apicomplexan parasite Toxoplasma gondii. (2002 Apr 2, EMBO J) PubMed / full text
   more detail about this publication

microneme
  • ""
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AAK58479
  • Localisation record: microneme
  • Comment: Only cytoplasmic tail used in construct. Original localisation of TgMIC12 appears to still be unpublished
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10083

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_067680 microneme protein, putative
MAILRSGIAVATLCVALGFTSQRGVVAETCPARFTAWTYCGGQNAMQERHNVACANIVESRECEKPQSCGDFTEWVPSVA
NCREGQMQQRHREGCENHVERRMCTSPECVGKWTEWTYCNSKGIQQRHNASCHVVEIRGCGDVPEGCGEFGPWSPPLDDF
NNCKHGVVYRRKREGCDLEEVRMCPKFDCSACSPNADCNKADSVCTCREGYEGDGLTCEPVNPCKNHNCSEHAVCFADGL
QAKCRCEKGYDGKEGAGTQDDPCIDRDECATNTHQCPAHSTCRNTEGSYDCDCKTGYAMSETGSCEDVNECATENSCPEN
SSCVNTAGSFECVCNEGFRMNAETQQCEDIDECAEEGGCSANATCTNSVGSYSCSCPEGYKGEGTRDSPCNKIDYCGEGL
HDCGEHATCRNEAVGFTCICDAGYTGLGKVSSPCVDIDECDREHPTHDCDSNATCTNTEGSFTCACNTGYTGEGRGADTC
TEIDECADGTANCAAEATCTNTPGSFKCTCLEGYSGDGFTCSDNDECQQEPAPCHQSATCQNTPGSFTCACNAGFRGDGH
TCGDIDECAEDPNACGAHAVCRNTVGSFSCNCEEGYGNLDEHRACHDINECEAEPERIPPNATCVNTDGSFEWSCNAGYE
HVGSQCQKINFCARGFCSPHASCQEVSNGTSYECTCQPGYVGDGVGPEGCADRDECQTENHCSTDENGGICTNTEGSYTC
SCKEGYRQLADGTCEDIDECASGHECHESATCHNTAGSYTCSCNPGFSGDGHECADINECETNAHDCGSHTTCENTVGSF
VCNCKEGFVHSDEKTCRDVDECAENKHDCSVHATCNNTEGSFECSCKAGFEGNGKECSDIQFCSAGRSDCAANADCAENE
AGTDYACSCHAGYRGSGHTSKGAADGCVDIDECTEGVDTCPRQGGRCVNTPGSYRCECEEGYTYTTKEDGTVECVDINEC
GVSEMNTCASKANGGVCTNTMGSYTCSCLPGYTPSDDGRVCTDIDECATENGGCSEHSQCRNLPGSYECVCDAGYEKVEG
SEHLCQDIDECAAGTATIPNNSNCVNTAGSYEFACKPGFEHKDNACSKIDYCGRGGCNSLATCEETADGTDYVCTCPKGF
VTQNEGRGADGCTDVDECAENGCAAYGSEGVICENTPGSFNCSCANGYLLNNGVCEEIDECAGSSSNTCADEGGICTNTP
GSYTCSCKPGYDQQGHDCVDINECTTQEPCGDNADCENTSGSYICKCKAGFEMRDNQCVDIDECATNTNECHNHRGRCIN
THGSYTCECIAGFIGDGKICINKNECQSGDFECGPNSHCVDTEGSYKCDCNSGYKQDPENPDSCIDRDECEIEGACDENA
DCTNLPGSFSCTCRAGYRQEGELCVKMNLCADDENGGCSPHADCEHLDKIVCTCRPGYEGDGITCTDIDECALNTDNCDS
HATCENTDGSYHCACGSGFTGDGFTCEDINECETGEHECDSNATCENIVGSYSCHCPTGFAGDGRSCSPVEVVPGQESCN
HWSAFTRCDPETHLSSRYCVDLPDKVESITCEVGSLPQPPTVAPGEGGEEDGNACGPWGPWSPCPGEGNNMSTRRREDTE
SEACVNQVETMECPTQAGQACGNYGAFSDCGVPLRGFAMAFPENCPELVAFAACDAPAPPQEDRCHSFSAWSKCTHIPGT
TLYEQTRSCDGMDLTESRFCTPDDEVGSDVSTDVASECGSLGEFGECVNGLQERSYSDCPDHKEVRQCSDESCSAFGEWS
PCGEPQQGLRIRKRRACDNVHCACVEAEVCGDATPEIEEEEGEHFPPEEGEVLPPYEEGPGEGELLPPEEEIPEGEHVPE
EEIPEGEHVPEEEIPEGEHIPEELPEGEHVPEEEIPEGEHVPEEEIPEGEHIPEELPEGEHVPEEEIPEGEHVPEEEIPE
GEHIPEELPEGEHVPEEFPEGEHIPEELPEGEHIPEEFPEGEHIPEELPEGEHVPEEEIPEGEHIPEEFPEGEHVPEEEI
PEGEHIPEEEFPEGEHVPEEEIPEGEHVPEEELPGGELIPEEEIPEGEHIPEELPEGEHVPEEEIPEGEHVPEEEIPEGE
HVPEEEIPEGEHAPEEETPAPEETEKEEEEGVPVAAIAGGVVGGVLLIAGGAGAAVYASQGGVEAAEDEVMFESEEDGTQ
AGENRESETVIEIEDDAWADMD

Gene-Specific Links for TGME49_067680

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins