ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_067550 (LRR1)

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and nucleus during tachyzoite

Who localised this protein by microscopy?

Daher, W., Oria, G., Fauquenoy, S., Cailliau, K., Browaeys, E., Tomavo, S., Khalife, J.
A Toxoplasma gondii leucine-rich repeat protein binds phosphatase type 1 protein and negatively regulates its activity. (2007 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during tachyzoite
  • "In tachyzoites, TgLRR1 was clearly present in the nucleus (green fluorescence) of all parasites examined, colocalizing with the propidium iodine (red fluorescence) (Fig. 7A). The strong nuclear localization of TgLRR1 can be seen in the yellow merged color (Fig. 7A, right panel). However, a cytoplasmic staining was also observed."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein, cMyc tag
  • Strain: 76K
  • Gene model mapping comments: Blast from DQ437870, annotation doesn't match but gene model agrees with RACE experiments in 17660360
  • Localisation record: nucleus and cytoplasm during tachyzoite
  • Other genes localised in this publication: serine/threonine protein phosphatase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11029

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF10_0320a leucine-rich repeat protein
  • PY02599 protein phosphatase-1 regulatory subunit 7 alpha2
  • PVX_111085 protein phosphatases PP1 regulatory subunit sds22, putative
  • PCHAS_051670 leucine-rich repeat protein
  • PKH_061720 leucine-rich repeat protein
  • NCLIV_038630 hypothetical protein, conserved
  • cgd6_750 protein phosphatase-1 regulatory subunit 7 alpha2
  • Chro.60097 protein phosphatase-1 regulatory subunit 7 alpha2
  • CMU_027480 protein phosphatase 1 regulatory subunit 7, putative
  • TA07655 protein phosphatase regulator subunit, putative
  • BBOV_II003040 protein phosphatase 1, regulatory (inhibitor) subunit 7, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_067550 hypothetical protein, conserved
MPDDTRTAGPPASGGAPQESRQDPPVSPGESESEGETGSPVTYLRLGVDLELDPTSDAITYQTSRIHKIENLQICPHLKR
LALNANDIEKIENLESTPELEELELYQNRVRKIEGLSTLSHLRVLDLSFNKVRKIENLETAVKLVKLYLSSNKIQVIEGL
ETLTRLELLELGSNRIREIQGIATLTELKELWLGKNKITEMKLPPLLNLQRLSIQSNRLTRWNDSLFSSCPSLEELYLSH
NRLTGAIPEAIGKLKKLKILDLGANAVDDMRAVAQLPELEELWINDNHISSLEAVKALKSMDSLRTLYLEGNPIHANLGP
SYRQNIVQIFPKLQQLDALLVSETVNIIQRPLSGKVGATKQKSIMKHNA

Gene-Specific Links for TGME49_067550

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins