ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_067480 ()

N2,N2-dimethylguanosine tRNA methyltransferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10761

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0109 N2,N2-dimethylguanosine tRNA methyltransferase, putative
  • PBANKA_141780 N2,N2-dimethylguanosine tRNA methyltransferase, putative
  • PY04503 N2,N2-dimethylguanosine tRNA methyltransferase
  • PY07448 probable n(2),n(2)-dimethylguanosine tRNA methyltransferase-related
  • PVX_122780 N(2),N(2)-dimethylguanosine tRNA methyltransferase, putative
  • PCHAS_141960 N2,N2-dimethylguanosine tRNA methyltransferase, putative
  • PKH_141850 N2,N2-dimethylguanosine tRNA methyltransferase, putative
  • TGME49_067480 N2,N2-dimethylguanosine tRNA methyltransferase, putative
  • NCLIV_038700 hypothetical protein
  • cgd4_3250 Trm1p. N2,N2-dimethylguanosine tRNA methyltransferase
  • Chro.40369 ENSANGP00000010185
  • CMU_018390 N2,N2-dimethylguanosine tRNA methyltransferase family protein
  • TP02_0525 N2,N2-dimethylguanosine tRNA methyltransferase, putative
  • TA13660 N2,N2-dimethylguanosine tRNA methyltransferase, putative
  • BBOV_II005710 N(2),N(2)-dimethylguanosine tRNA methyltransferase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_067480 N2,N2-dimethylguanosine tRNA methyltransferase, putative
MACPAAASDAAKTMASPQGDYGSGHGDQATSGFIREGLVRIMSSGNNEVFYNPVQVFNRDLSIMVIKAFAHQQRQEIKRR
GEKTAARTKEEGKEAPAPLRFEGLNVLEPLAATGLRSLRYLTELDDEVRHVVANDLDPAALQAMERNAELNKVVREKLHL
TCSEGAHLMYVLARPGNLHPGTLKKIHSLPAGSSIPSTFDMNPPLFSFSLPPLSLFLTPRQRPRNQANDNTSAAHASCGS
REDSTAVSQQGVSGPDGEPCEGAKQDAQSSHSASEKAGVGTKHVKGQHATLVNGGTHPSDLPLFFDVVDVDPYGSVAPFL
DAAIQAVRPGGLLCLTSTDMPVLCGNSPEVTFYKYGGAALKARYMHEMALRLVLYAACSCAAKYKKIVVPLLSCSVDFYV
RIFVQVFDSAEGCKDVHSHSAIVHQCVNCDCFRVLPLGSEVHGGQKDSAESSESNQTKRGGESRGCASTRGSRKRKAALL
PEEVKGRCDECHGRMVIGGPFYAGPLYQSAFVQACLDLCETAKERLPGLTMVARIKGLLTAIKEELHQVPLYYHLPTMCN
RAKLEMIRPVQFKAALVRLGYKVSHFHREPQAIKTDAPSVVVFDILRTHAQKHPPKHPEKFPLLQKEICTKEVDLTPMAS
VTSQSPNVPKWLPNPTPYWGPKSRASSNKRQNASTCTPRTQKRPREDETYDAENPLV

Gene-Specific Links for TGME49_067480

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins