ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_067390 ()

DNA-directed RNA polymerases I and III subunit RPAC1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11308

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0445 DNA-directed RNA polymerase I, putative
  • PBANKA_090570 DNA-directed RNA polymerase I, putative
  • PY01971 DNA-directed RNA polymerases i and iii 40 kDa polypeptide
  • PVX_092770 DNA-directed RNA polymerase I, putative
  • PCHAS_070690 DNA-directed RNA polymerase I, putative
  • PKH_094080 DNA-diDNA-directed RNA polymerase I, putative
  • TGME49_067390 DNA-directed RNA polymerases I and III subunit RPAC1, putative
  • NCLIV_038790 RNA polymerase II, related
  • cgd8_300 RNA polymerase III C5 subunit
  • Chro.80042 DNA-directed RNA polymerase I
  • CMU_024220 DNA-directed RNA polymerases I and III subunit RPAC1, putative
  • TP02_0766 DNA-directed RNA polymerase I, putative
  • TA14965 DNA-directed RNA polymerases I and III, 40 kDa polypeptide, putative
  • BBOV_III011540 DNA-directed RNA polymerase, alpha subunit, N terminal domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_067390 DNA-directed RNA polymerases I and III subunit RPAC1, putative
MSLPGHEGRPSASIPLHSNRLVCAAEGPRHTNSGGYAGAFLSSSYVDDVFSIDKFCERTSLKFLSVSPERVVFELKGVDA
AIPNALRRILISEVPTVAIETVQIWQNTGVVQDEVLAHRLGLIPFIVDPTALNYRQPNQEVTDENALRVSLHVKCTEQSL
GPHQTSLPVYAKHIKWEPMSPSQKEAFAANPPRAVHPDILITKLRPGQEIELKAYLEKGVGKTHAKWSPVCTAVYRLEPE
IVFKESIQGEDASDLCSLCPMGVFDIEDTTGEAYARYPRNCTTCRACIERFPKEIELRKIKDHFIFSIESTGSVPAPLLF
KMAIEILKEKALTFRQIIDLKLVSGN

Gene-Specific Links for TGME49_067390

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins