ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_067350 ()

small nuclear ribonucleoprotein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11239

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0266 small nuclear ribonucleoprotein D1, putative
  • PBANKA_092280 small nuclear ribonucleoprotein D1, putative
  • PY00270 small nuclear riboprotein Sm-D1-like protein
  • PVX_091895 small nuclear ribonucleoprotein Sm D1, putative
  • PCHAS_092160 small nuclear ribonucleoprotein D1, putative
  • PKH_092310 small nuclear ribonucleoprotein D1, putative
  • TGME49_067350 small nuclear ribonucleoprotein, putative
  • NCLIV_038830 Sm protein, related
  • cgd5_2220 small nuclear ribonucleoprotein D1. SM domain containing protein
  • Chro.50158 small nuclear ribonucleoprotein smd1
  • CMU_039580 small nuclear ribonucleoprotein Sm D1, putative
  • TP01_0949 small nuclear ribonucleoprotein D1, putative
  • TA06565 small ribonucleoprotein D1, putative
  • BBOV_IV008240 small nuclear ribonucleoprotein Sm subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_067350 small nuclear ribonucleoprotein, putative
MKLVRFLMRLANETLVIELKNGTVIHGTVVGVDISMNTHLKNVKMTMKQGNPTSLEHLTIRGNNIRYFILPDSLPLDTLL
IDDTPLQRPAREAGRPIQRLRGRGRGRGGSAFRPRGGLGRR

Gene-Specific Links for TGME49_067350

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins