ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_067080 ()

26S proteasome subunit 4, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10949

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0081 26S proteasome regulatory subunit 4, putative
  • PBANKA_120660 26S proteasome regulatory subunit 4, putative
  • PY00768 26S proteasome subunit 4-like protein
  • PVX_094615 26S proteasome regulatory subunit 4, putative
  • PCHAS_120730 26S proteasome regulatory subunit 4, putative
  • PKH_080720 26S proteasome regulatory subunit 4, putative
  • TGME49_067080 26S proteasome subunit 4, putative
  • cgd4_1170 26S proteasome regulatory subunit S4 like AAA ATpase
  • Chro.40138 26S proteasome AAA-ATPase subunit RPT2a
  • CMU_015340 26S proteasome subunit 4, putative
  • TP01_0845 26S proteasome regulatory subunit 4, putative
  • TA05950 26S proteasome subunit 4, putative
  • BBOV_IV009290 26S protease regulatory subunit 4, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_067080 26S proteasome subunit 4, putative
MGNAQPRGGGFPGGSEDDKKKERKRLEAAPPTHIGKRKKKGKGPVGHSRLPTVTPITKCRLRLLRLERIKDYLLLEEEYI
LNQEQRKPAEEKNEEDVNRVDELRGSPLSVGNLEEIIDEQHAIVSSSIGPEYYVNILSFVDKDLLEPGCSVLLHNKTSSI
VGILNDEVDPLISVMKVEKAPLETYADIGGLEKQIQEVKEAVEFPLTHPEFFDDIGISPPKGVILYGPPGTGKTLLAKAV
ANETSATFLRVVGSELIQKYLGDGPKLVREMFKLAHEHAPSIVFIDEIDAVGTKRYDATSGGEKEIQRTMLELLNQLDGF
ESKGDVKVIMATNRIESLDPALIRPGRIDRKIQLPNPDAKTKRKIFQIHTAKMTMADDVDLEEFVMAKDELSGADIKATC
TEAGLLALRERRMKITQEDLRKAKEKALYQKKGNIPESLYL

Gene-Specific Links for TGME49_067080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins