ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_066990 (BetaCOP)

coatomer beta subunit, putative, a gene from Toxoplasma gondii

Compiled localisation
between endoplasmic reticulum and golgi during tachyzoite

Who localised this protein by microscopy?

Hager, K. M., Striepen, B., Tilney, L. G., Roos, D. S.
The nuclear envelope serves as an intermediary between the ER and Golgi complex in the intracellular parasite Toxoplasma gondii. (1999 Aug, J Cell Sci) PubMed / full text
   more detail about this publication

between endoplasmic reticulum and golgi during tachyzoite
  • "Staining with antiserum raised against recombinant T. gondii β-COP confirms its association with the apical juxtanuclear region"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: blast from DQ279721.1, annotation matches
  • Localisation record: between ER and golgi during tachyzoite
  • Other genes localised in this publication: heat shock protein 70, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11101

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_066990 coatomer beta subunit, putative
MELERNCMLYIYSSRGDAPSTAELQKKIESPNEATKAEGMQDLIIGMTQGEAYTRLLMTVIRYAMPSKDKRVKKLTQLYL
EIVGKCRPDGSLKEEMILVCNALRNDLMSPNEYVRGSTLRLLSKIRQFKVLEPLVEAILQNLTHRHSYVRRNAVMCVYSI
VKNFGLDAIPAAIDQIEQMLLSEGDLTTKRNAFLVLVHCASKRAIQFILQQRSEDGTGGLGFLLSSGDLFQLALLELLRK
VCRQKQQQKAGLLRLIVSILPNTLPSVAYEGACSLLALSRAPVSLKAAAGAFASLLCGNSDNNVKLIVLDRLQECVQRAS
RRTMEEFVIDLLRGLQTPSLEVRRKILDLVLQIVGKNSVEQLLNVLKRELLRTAEPEQLTVPRTMEYRRLLIKAVHSCCT
RFPEAAASVVNVLIDFLGDPDVTTATEVAVVVRELVATCVHLRSRIISRVVDAFPDLAHARVLRVSLWMLGEFCEDSELL
DSFLTAVYAACSPLPFTSGDSGGAEGEQRSGCQPKLKMTTRTVVLEDGTYGTEDVYESVNEKGDSSAKAGKTALRKFILG
GDFLLASTVAVTCAKLILKTSDEVHAQLVEEFERHREAVQEKAGRRTLTGDAQARETLLERQELEGKVAPVKLRASTEQK
TRVLYLVACLLKFLRLSSSGAGAHSDAAIRVCQSLRALCGLMTGLEKEKAFVRHWVHHGRFALERVLALGPVSDDPFTWN
LKDAEDEKTVSAPDDLAFFRQLRPDRQSLMVASEGVAAVGEDSLEEDEIYYSACAGLARGAELEEVDETEADLQLTVGGA
GGTSPSLFGGNAKDDAALFQQRLAKVQPITGQADPLYVEAFLQVNQFDLLVEMLVVNRTQDSLQNVTVELSTHGDLKLVE
RPAPVSLAPGQQAVLHAPIKVRSTEAGIILGYVTFSRRGSSDKECLVLNELHIDVLDYIERRWTCELAFRSMWAEFEWEN
KIHVNTSFTDVSEFLEHLMKMTNLTVVGFRPPASVMRRLKFSAACAGLDEAERAAGDGEEDEDRYLQSVRKIPTLRKLSE
SSSFFAVNLYSRSIFGEDALVNVSIEKLPGGKLAGSIRIRSRTQGIALSLGDRITVVQRGLTK

Gene-Specific Links for TGME49_066990

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins