ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_066960 (beta tubulin)

tubulin beta chain, a gene from Toxoplasma gondii

Compiled localisation
apical and inner membrane complex microtubules and nucleus during tachyzoite

Who localised this protein by microscopy?

Striepen, B., Crawford, M. J., Shaw, M. K., Tilney, L. G., Seeber, F., Roos, D. S.
The plastid of Toxoplasma gondii is divided by association with the centrosomes. (2000 Dec 25, J Cell Biol) PubMed / full text
   more detail about this publication

apical and inner membrane complex microtubules and nucleus during tachyzoite
  • "Both NH2- and COOH-terminal fusions of YFP with b-tubulin showed general cytoplasmic staining without incorporation into any specific structure, presumably due to steric limitations imposed by the incorporation of a bulky GFP tag into microtubules (data not shown). In contrast, YFP-a-tubulin labeled the subpellicular microtubules of both the mother and developing daughter parasites (Fig 5G and Fig J). We also observed a spot of intense staining at the very apical end of the parasite (Fig 5 J, arrowhead), probably attributable to either the conoid or the apical polar rings (Nichols and Chiappino 1987 ; Morrissette et al. 1997 ). An additional focus of intense labeling in developing daughter parasites was observed in the nuclear region (Fig 5 G, double arrow). Double labeling with centrosome- and microtubule-specific antibodies (not shown) reveal that this label represents ends of the intranuclear mitotic spindle. "
  • Microscopy type: Light
  • Microscopy method: YFP tag, GFP tag
  • Strain: RH
  • Gene model mapping comments: Blast from M20025, annotation matches
  • Localisation record: inner membrane complex microtubules and apical and nucleus during tachyzoite
  • Other genes localised in this publication: tubulin alpha chain, acyl carrier protein, proliferating cell nuclear antigen 1, ferredoxin NADP+ oxidoreductase, putative, membrane skeletal protein IMC1, caltractin (centrin), putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10079

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_066960 tubulin beta chain
MREIVHVQGGQCGNQIGAKFWEVISDEHGIDPTGTYCGDSDLQLERINVFYNEATGGRFVPRAILMDLEPGTMDSVRAGP
FGQLFRPDNFVFGQTGAGNNWAKGHYTEGAELIDSVLDVVRKEAEGCDCLQGFQITHSLGGGTGSGMGTLLISKVREEYP
DRIMETFSVFPSPKVSDTVVEPYNATLSVHQLVENADEVQVIDNEALYDICFRTLKLTTPTYGDLNHLVSAAMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFLIGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMCASDPRHGRYLTASAMFRGR
MSTKEVDEQMLNVQNKNSSYFVEWIPNNMKSSVCDIPPKGLKMSVTFVGNSTAIQEMFKRVSDQFTAMFRRKAFLHWYTG
EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFDEEEGEMGAEEGA

Gene-Specific Links for TGME49_066960

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins