ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_066730 (LeuRS2)

leucyl-tRNA synthetase, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast and not cytosol and not mitochondrion during tachyzoite

Who localised this protein by microscopy?

Pino, P., Aeby, E., Foth, B. J., Sheiner, L., Soldati, T., Schneider, A., Soldati-Favre, D.
Mitochondrial translation in absence of local tRNA aminoacylation and methionyl tRNA Met formylation in Apicomplexa. (2010 May, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast and not cytosol and not mitochondrion during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11105

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_066730 leucyl-tRNA synthetase, putative
MPFSAHPGKTGSIGKFGGVPQWSSRQSRGLLFLKCGHKCGGYGVSVSLVRFLHGSCASTFVSTNDGCHSLNDARARTGRR
PLPPVHFVSLSTSSPATLYAFHSSSAVALYPFKAIETKWTKYYAENSGDFSPPLPRQHNNLEDSERVRELKATRPESHPL
AGTPSEETSHHSDLTAFPSLLERRKFYILSMIPYPSGAGLHVGHSLTYTVADVVARYQRLRLRGELVKSRENADETRRVS
SSASNRSCFTVCKEASDAESPTLANRQAESPLTELRGSLESTSHHDGRLAQDLKELRAFKALRSIHDKPEQGPIQKDQVA
CSEANVQGQTTSEASAEGARQRRRAAPQPDVLHVMGWDSFGLPAEQHALASGISPRLSVQTNIDRFRQQLRRLGVCVDWR
REVNTSSPEFYRWTQWIFVQMMKRGLVYEKLANVNWCEGLGTVLANEEVIDGFSERGGFPVSSRQLRQWHLRITAYADRL
LDGLKSLDWPADVKRMQRNWIGRRDVLLLDLSVSDCVDGVEACEEPHEQERAGFNDAVVPSATCRNYLEEKAKGGNRVSA
KEDRCDGQFSGVMVDHPVIPDKKLPVWMSDSLFTQLHGFGGLYNETDALLVVPESQARAREFAQQKGIHVAHIIEMNGEA
KRSSKGGKQLDLKSNDVIQKTNRGADPTKNAGEDVNQNTEKSGTQGAEQSGEGVETAAAVAHIDEGYGSAQVPTLSCSSG
ALDAKLVNSSVEGLLSLDGMSLGCARQEVIRFFTMTNSRGRHEVRYAMRDWLFSRQRFWGEPIPLIRSRKHGEASHVVPV
NEADLPVLLPEELPLKGGSTPTKDEVTTQTTVQEKSEIEARDLSLHLSASHNTEKTTDVNDSASQKGASTRTSLSPLLTQ
DDETTATTLSPLYSLPEWWNVTLAVDQVDGMNMATSVKNSTEDELEKATSSSSAEGSAGGPQAVSLQRETSTMPQWAGSS
WYFLRFLDPRNTREPFTRETARFWMPVDMYVGGKEHAVTHLLYARFWHKVLHDLGRVACDEPFQRLVTPGIILGSPKYFM
FKRQDTGKIVSSETVELMDKTNLTREENTHGVQAVAGGSANILPKEFNLSFQVPDSPSEILFGVHAPSGQPVYGVEVPPS
AVDVSAKGMPVLKVNGDVQVYRRHEKMSKSRGNVVSPDSIIDAYGADSLRLYLLFMGPLEARKMWNTSGVVGAFRFLNRV
WNLLVLSAKHHSSKQEGHHCSTVTGFATVDNSLSSNAQGVTPATLNLTNTPPSSFERELMKLLVARVTADIERMSLNTAI
AALMANVRKLTAWTAKGNRLSVGTAIDLVKLLHPFAPFVTEELWQMIHASFPDVSLYSTTPSLLASATWPTPSKEESRVH
PRSGRVAESENEADSIVFSIHVDGKLQGTVHVPRSSMHDEGTVSALATTSPCLKKWEILLKSGGRGFTKIVCIPARRVIN
FVTGTVASKQVLGHQHVCRQNQSRK

Gene-Specific Links for TGME49_066730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins