ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_066130 (TPRX2, Prx2)

glutathione/thioredoxin peroxidase, putative, a gene from Toxoplasma gondii

Compiled localisation
cytosol during intracellular tachyzoite

Who localised this protein by microscopy?

Ding, M., Kwok, L. Y., Schluter, D., Clayton, C., Soldati, D.
The antioxidant systems in Toxoplasma gondii and the role of cytosolic catalase in defence against oxidative injury. (2004 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

cytosol during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23133

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_066130 glutathione/thioredoxin peroxidase, putative
MESPTTLTEERADVPAANIGAALEQPDEVPHLSPVIRQVDIIEEKTSGDDNERFVKIVVKDFEGQERGTFCSDPEVIPVF
GPGNIPAAFVTIRTRDLDGNEHVMEEYDGKVKLITNVASLSKDARKTYDELRQIYDRFLPQGFEILAFPCQQYVPEEYVH
TEDIKTFLADHNVGFPVFEMTAVNGPETHPVFLYCKWNSDEFYRDGQLNNLTGHFGKFLLDRDNRVYKFYPPDTNPLRLV
EDIKKLLNGELTGKIRGPDGKLYHQPGTVSQENQTTWS

Gene-Specific Links for TGME49_066130

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins