ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_066120 (TPX1/1, TPX1/2)

glutathione/thioredoxin peroxidase, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast and cytosol and mitochondrion during intracellular tachyzoite

Who localised this protein by microscopy?

Pino, P., Foth, B. J., Kwok, L. Y., Sheiner, L., Schepers, R., Soldati, T., Soldati-Favre, D.
Dual targeting of antioxidant and metabolic enzymes to the mitochondrion and the apicoplast of Toxoplasma gondii. (2007 Aug 31, PLoS Pathog) PubMed / full text
   more detail about this publication

apicoplast and mitochondrion during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10219

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_066120 glutathione/thioredoxin peroxidase, putative
MLPLCASSQMYLGQECLSCPVLPRLCLATCLGALYGRAFWRTNKRTAGHGKKWLGAHGKEKFHCFSGSFFLAKTLTSAKS
FFGRFSSLVPPSVFTTPRKQSAFRFSHLIPTRSPLSAQYPGLKFLSSFSFLRMGIGGSRAAFAPDQIPVSFSTITFNDIY
GVQRSLGEWDGKVKIVVNVASNCGLTKAHNKEFIELREKIGTDAFEILAFPSRQFANQEFADIAETQQFCERVKIPFPVF
TTSDVNGPETNPVFLYCKWNSDSFYHPVKNSKSAKLSDIGWNYGKFLVDKDNGVYKYYGPRTKPLEMEEDIRKLIAGQAK
GMKRNAAGELKPL

Gene-Specific Links for TGME49_066120

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins