ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_065450 (Hexokinase, HK)

hexokinase, a gene from Toxoplasma gondii

Compiled localisation
cytosol during intracellular tachyzoite

Who localised this protein by microscopy?

Pomel, S., Luk, F. C., Beckers, C. J.
Host cell egress and invasion induce marked relocations of glycolytic enzymes in Toxoplasma gondii tachyzoites. (2008 Oct, PLoS Pathog) PubMed / full text
   more detail about this publication

cytosol during intracellular tachyzoite

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10257

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_065450 hexokinase
MQPRQPGDEAKQLAELEVVRKMMTPTREVLLELHESFLKELQRGLEMHKRHGITWVPEECSMKMLDSCVSNLPTGAEVGE
AYAIDFGGSTCRAVRCSLLGKGKMEIIQDKICLRSAEHRCTKGFMDKKAGGKELFDQFAMCIRGLMDRSGDLKKAEETNT
PVPVGFTFSFPCAQAALNSSFLIEWTKGFETGRENPDRVEGKDVAVLLADALQRHNVPAVCKAIVNDTVGTLVSCAYQRV
PGTPECRVGLIIGTGFNACYVEPEASNYGYTGTVVNMEAGNFHKDLPRNEIDVEVDEKTHNRGKQQFEKLVSGYYIGEIV
RVAAVRVFGARAPEKASVRHSIHGETASTIRDDHSQDKAASIQAIKECWGVTMDLDDIKCIWEICRLVFDRSAAFAATLA
VALCYRTGRLDTGSTVGIDGALYVKNQWYREAVEYYTKLVAGDAAKNIHYCIADDGSGKGAALIADVN

Gene-Specific Links for TGME49_065450

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins