ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_064080 (ACP)

acyl carrier protein, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during 24 hours after tachyzoite infection and intracellular tachyzoite and tachyzoite
apicoplast lumen and not apicoplast periphery

Who localised this protein by microscopy?

Agrawal, S., van Dooren, G. G., Beatty, W. L., Striepen, B.
Genetic evidence that an endosymbiont-derived endoplasmic reticulum-associated protein degradation (ERAD) system functions in import of apicoplast proteins. (2009 Nov 27, J Biol Chem) PubMed / full text
   more detail about this publication

apicoplast during 24 hours after tachyzoite infection, apicoplast lumen and not apicoplast periphery

van Dooren, G. G., Reiff, S. B., Tomova, C., Meissner, M., Humbel, B. M., Striepen, B.
A novel dynamin-related protein has been recruited for apicoplast fission in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

apicoplast
  • "TgDrpA localizes in many small patches throughout the cytosol of T. gondii, and a major component of TgDrpA fluorescence clusters at the apical end of the cell (FigureĀ 2A). Colocalization with the apicoplast stromal marker acyl carrier protein (ACP) indicates that this cluster occurs around the periphery of the apicoplast (FigureĀ 2A). "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast
  • Comment: strain information not found
  • Other genes localised in this publication: dynamin-like protein, putative, membrane skeletal protein IMC1, phosphatidylinositol-4-phosphate 5-kinase, putative

Huynh, M. H., Carruthers, V. B.
Tagging of endogenous genes in a Toxoplasma gondii strain lacking Ku80. (2009 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast

Saito, T., Nishi, M., Lim, M. I., Wu, B., Maeda, T., Hashimoto, H., Takeuchi, T., Roos, D. S., Asai, T.
A novel GDP-dependent pyruvate kinase isozyme from Toxoplasma gondii localizes to both the apicoplast and the mitochondrion. (2008 May 16, J Biol Chem) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite
  • "Localization of TgPyKII1stM-(1-357)-YFP-HA, TgPyKII2ndM-(19-357)-YFP-HA, and TgPyKII3rdM-(93-357)-YFP-HA. Parasites were transfected with TgPyKII1stM-(1-357)-YFP-HA (A), TgPyKII2ndM-(19-357)-YFP-HA (B), or TgPyKII3rdM-(93-357)-YFP-HA (C) under tubulin (in these panels) or dihydrofolate reductase (not shown) promoters and labeled with MitoTracker Red CMXRos (labeling mitochondrion, red) and anti-ACP antibody (labeling apicoplast, blue)"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during tachyzoite
  • Other genes localised in this publication: pyruvate kinase, putative, ferredoxin NADP+ oxidoreductase, putative, heat shock protein 60

Dautu, G., Ueno, A., Munyaka, B., Carmen, G., Makino, S., Kobayashi, Y., Igarashi, M.
Molecular and biochemical characterization of Toxoplasma gondii beta-hydroxyacyl-acyl carrier protein dehydratase (FABZ). (2008 May, Parasitol Res) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite
  • "To prove that TgFABZ localizes in the apicoplast, the TgFABZ was co-stained with a known apicoplast marker TgACP."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Beverley
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during tachyzoite
  • Other genes localised in this publication: (3R)-hydroxymyristoyl ACP dehydrase, putative, bradyzoite antigen, putative

Nishi, M., Hu, K., Murray, J. M., Roos, D. S.
Organellar dynamics during the cell cycle of Toxoplasma gondii. (2008 May 1, J Cell Sci) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Brydges, S. D., Carruthers, V. B.
Mutation of an unusual mitochondrial targeting sequence of SODB2 produces multiple targeting fates in Toxoplasma gondii. (2003 Nov 15, J Cell Sci) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite
  • "The apicoplast is delineated as a single, discrete dot of GFP fluorescence in pTgACP/GFP transfected cells (third row, four-cell stage)"
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 2F
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during intracellular tachyzoite
  • Other genes localised in this publication: iron-containing superoxide dismutase, hypothetical protein

Striepen, B., Crawford, M. J., Shaw, M. K., Tilney, L. G., Seeber, F., Roos, D. S.
The plastid of Toxoplasma gondii is divided by association with the centrosomes. (2000 Dec 25, J Cell Biol) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite

DeRocher, A., Hagen, C. B., Froehlich, J. E., Feagin, J. E., Parsons, M.
Analysis of targeting sequences demonstrates that trafficking to the Toxoplasma gondii plastid branches off the secretory system. (2000 Nov, J Cell Sci) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite
  • "ACP-GFP localized to a single, dot-like region of the cell"
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: blast from AF038922, annotation matches
  • Localisation record: apicoplast during tachyzoite
  • Comment: 9770490 also showed acp leader sufficient for targeting
  • Other genes localised in this publication: ribosomal protein S9, putative, 50S ribosomal protein L28, putative

Waller, R. F., Keeling, P. J., Donald, R. G., Striepen, B., Handman, E., Lang-Unnasch, N., Cowman, A. F., Besra, G. S., Roos, D. S., McFadden, G. I.
Nuclear-encoded proteins target to the plastid in Toxoplasma gondii and Plasmodium falciparum. (1998 Oct 13, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite
  • "Immunodetection of S9 and ACP (respectively) in intact T. gondii cells demonstrates that these proteins are restricted to a distinct region of the parasite similar to the location of the apicoplast. "
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag, antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during tachyzoite
  • Other genes localised in this publication: ribosomal protein S9, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10539

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_064080 acyl carrier protein
MEMHPRNAGRKTLLALALFMATSIASSYGFVSPGLIRFNYRYGTCPNMSSGVCATPSTASLGTLGQPAGTVARRPGPFRS
VSANVIGSPSSALFAADEASSDDRPLLERVKDVVADQLGVDRARINPESNFIKDLDADSLDSVELVMAFEEKFGVSIPDE
EASKIATVQDALSYIEKAKSATA

Gene-Specific Links for TGME49_064080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins