ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_063730 ()

glycerol-3-phosphate dehydrogenase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10698

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFC0275w FAD-dependent glycerol-3-phosphate dehydrogenase, putative
  • PBANKA_040480 FAD-dependent glycerol-3-phosphate dehydrogenase, putative
  • PY05303 putative FAD-dependent glycerol-3-phosphate dehydrogenase
  • PVX_119445 FAD-dependent glycerol-3-phosphate dehydrogenase, putative
  • PCHAS_040570 FAD-dependent glycerol-3-phosphate dehydrogenase, putative
  • PKH_083350 FAD-dependent glycerol-3-phosphate dehydrogenase, putative
  • TGME49_063730 glycerol-3-phosphate dehydrogenase, putative
  • NCLIV_024220 glycerol-3-phosphate dehydrogenase, putative
  • TA17925 fad-dependent glycerol-3-phosphate dehydrogenase, putative
  • BBOV_III000930 FAD-dependent glycerol-3-phosphate dehydrogenase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_063730 glycerol-3-phosphate dehydrogenase, putative
MRRFGRVFACSAGLVGLGGAAAYGGLYYNHKKSMVPKETRYYSSLAGEAEGRLAHLPPSREAMIERMKKERFDLLVIGGG
ATGSGVALDAATRGLSCCLVERGDFADGTSSRSTKLIHGGVRYLEKAFEELDFRQLYLVWEALEERSHMLSAAPYMNHPL
AILMPVYKYWQVPYFWAGVKVYGLLSKLVCCFETGVPPSSFFPAATSAFSFPLLPAAGLKGSLLYFDGQMNDSRMNLQLA
LTASLDGYVEGMKGACVGNHLNVVDILKDGNGKAAGARVQDRETGEEFDIHSKTVVNCAGPFSDAVRTMADPTQPKLVEP
AAGIHIVLPHWYTSASPYGLLLPKTTDGRVLFMLPWQGATIAGTTDAPCELSDAPQATEEEVAWVTRELASYLKMDEKRL
RDDVRSVWKGIRPLISHIPQPNEEAVTAAATKDAQVSTANVVRSHYIVVDEKTGLVSVLGGKWTTYRRMAEETLDALLAA
HRDKVATTRSCRTKSLLIQGAVDPSGALPPKECIPASGMLEVELEKENPFLSFSQARHLVESYGFLARSVCQIAKERPDL
SQPLISDEAFPFLKAEVLYGVRYEMARSVSDVLARRMRLAFVDVAKAEACIDEVARIMGEELKWSSAKLEKKKEEAAAFL
KTFRCLPASSEVA

Gene-Specific Links for TGME49_063730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins