ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_063710 (ACAT1α, ACAT1β) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

sterol O-acyltransferase, putative, a gene from Toxoplasma gondii

Compiled localisation
cortical endoplasmic reticulum and perinuclear endoplasmic reticulum

Who localised this protein by microscopy?

Nishikawa, Y., Quittnat, F., Stedman, T. T., Voelker, D. R., Choi, J. Y., Zahn, M., Yang, M., Pypaert, M., Joiner, K. A., Coppens, I.
Host cell lipids control cholesteryl ester synthesis and storage in intracellular Toxoplasma. (2005 Jun, Cell Microbiol) PubMed / full text
   more detail about this publication

cortical endoplasmic reticulum and perinuclear endoplasmic reticulum
  • "Both the cortical and perinuclear ER were intensely labelled. No labelling was observed on other parasite structures such as at the surface of lipid bodies or in rhoptries. In addition, anti-TgACAT1α or -β antibodies colocalized with antibodies against TgDAGT1 to the parasite ER"
  • Microscopy type: Light and EM
  • Microscopy method: HA tag
  • Strain: RH
  • Gene model mapping comments: Blast from AY562994, gene model inconsistent Alternate transcription?
  • Localisation record: Cortical ER and perinuclear ER
  • Comment: Confirmed with c-myc tag, but data unpublished
  • Other genes localised in this publication: -
  • "Both the cortical and perinuclear ER were intensely labelled. No labelling was observed on other parasite structures such as at the surface of lipid bodies or in rhoptries. In addition, anti-TgACAT1α or -β antibodies colocalized with antibodies against TgDAGT1 to the parasite ER"
  • Microscopy type: Light and EM
  • Microscopy method: HA tag
  • Strain: RH
  • Gene model mapping comments: Blast from AY562995, gene model inconsistent Alternate transcription?
  • Localisation record: Cortical ER and perinuclear ER
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11680

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_063710 sterol O-acyltransferase, putative
MYTSNSQCRGQLLDVRLLHFLPFLKNLKFKRRRPGQLSVWILTAHARRPALQNEGQCASGKLPGSETSEESLPHQQGAEP
RVSLEATMCSPSPEKTGPPCSPCPESCGKQQGNNTDPCTVSSPCESRGSRRTMETARVGASSGKAEDEHARAEGREPAQG
THEARDEEKSRDRRPASGPGGSELDKMEKEDGKTFPSKLDFFDANSDLARSDFRGVAVLLFIAAIFYLVANPILRWYDSK
EFVDPSHLTQSAAIGYAVCSCLYNAVCDMSLTSLASADFRLACALRPLRWPIIPAAFVQMIAVVQFMKMHSYSSTNMNFC
DDMRQGKQTLGYPENVTLRNFCDYLFCPVLVYEPMYRRGGGFRPTYFVFKLFSMVGAMVVMYLACTSYLIPTMMRSPSMS
ITEAIFSLVFPFLFLDILIFYILFECICNLAAEITNFANRNFYDDWWNSTNWDEYSRKWNKPVHRFLLRHVYMETQQRYK
WSHQTAAFATFLFSALLHEMILAVCFRFVRLYLFGLMLLQLPLIALGRFYRHKKMVANAIFWACLMLGPPLLGLAYGREW
AQIHFYNAHADHQPLRLF

Gene-Specific Links for TGME49_063710

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins