ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_063520 ()

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_16432

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0460w conserved Plasmodium protein, unknown function
  • PBANKA_081070 conserved Plasmodium protein, unknown function
  • PY03130 repetitive proline rich protein, putative
  • PVX_098915 hypothetical protein, conserved
  • PVX_135260 hypothetical protein, truncated
  • PCHAS_081100 conserved Plasmodium protein, unknown function
  • PKH_070690 hypothetical protein, conserved in Apicomplexan species
  • TGME49_063520 hypothetical protein, conserved
  • NCLIV_024420 hypothetical protein
  • cgd7_1660 STOP repeat protein involved in microtubule stabilization (possible variant metal binding site at N-terminus)
  • Chro.70196 similar to protein MGC35182
  • CMU_033680 hypothetical protein, conserved
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_063520 hypothetical protein, conserved
MSGGNSNTPKKLPSEEGSDYGYPQKPQKYLPKSEQAEPDYSACCKGNDAYKGASHGTVQFSHPEEAQKYAGAAAGAETIQ
RGRERVAADRQPRAAGDVPARRLHLSDVDEAHRGQSPSRHPGYCVEELCTCGMHKCIPSRAPVPFTGSTQYRQEFVPKPL
PPPTQVSQVTLPPSLPFEAESSYRTEFVAKPLPPPAKFSEVKLPPTLPFHGESAYRTDYVPKPLPEVAKPVEVKLPPTLP
FNAQSCYRSEYVAKPLPPPVQTVEVKLPPSLPFEGSTHYRDEFQVKPLPPATKVTEVKLPPSLPFDATSMYRSDYVAKSN
PICPVSKLPQYPAATYPQNHVFWDPDTKQWY

Gene-Specific Links for TGME49_063520

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins