ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_063470 ()

ubiquitin carboxyl-terminal hydrolase isozyme, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11179

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0576 ubiquitin carboxyl-terminal hydrolase isozyme L3
  • PBANKA_132410 ubiquitin carboxyl-terminal hydrolase isozyme L3, putative
  • PY01755 hypothetical protein
  • PVX_117435 ubiquitin carboxyl-terminal hydrolase, putative
  • PCHAS_132740 ubiquitin carboxyl-terminal hydrolase isozyme L3, putative
  • PKH_124560 ubiquitin carboxyl-terminal hydrolase, putative
  • TGME49_063470 ubiquitin carboxyl-terminal hydrolase isozyme, putative
  • NCLIV_024470 hypothetical protein
  • cgd8_3200 ubiquitin C-terminal hydrolase of the cysteine proteinase fold
  • Chro.80372 ubiquitin carboxy-terminal hydrolase L1; gracile axonal dystrophy; protein gene product 9.5
  • CMU_023740 ubiquitin carboxyl-terminal hydrolase, family 1 protein, putative
  • BBOV_III010630 ubiquitin carboxyl-terminal hydrolase, family 1 protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_063470 ubiquitin carboxyl-terminal hydrolase isozyme, putative
MEGKSACKWLPLEADPLLFAQYVNELGGPVAAAVEHGGETEKRHEGHEALLSFEDVLALESWAAEMVAHPTVAVLLLFPI
TEATEKGRREQDKQTAGQSLNNVWFTKQTVGNACGTVALLHCLANLPREKFPLQPNRFLEHFLKETADLSPEQRAKVLET
DRSLASAHKSFEQQGQSAVPPRESDVDTHFVAFVFHEGHLVELDGRRATPVDHGSVEGGATLEDAARNQRLLKMTLNVIQ
KEFVEKCPGELRFQVIAVGDAKAA

Gene-Specific Links for TGME49_063470

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins