ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_063290 (ROM2)

rhomboid-like protease TgROM2, a gene from Toxoplasma gondii

Compiled localisation
golgi apparatus during tachyzoite
not microneme and parasite plasma membrane and trans-golgi network during tachyzoite

Who localised this protein by microscopy?

Sheiner, L., Dowse, T. J., Soldati-Favre, D.
Identification of trafficking determinants for polytopic rhomboid proteases in Toxoplasma gondii. (2008 May, Traffic) PubMed / full text
   more detail about this publication

golgi apparatus and parasite plasma membrane and trans-golgi network during tachyzoite
  • "The localization of R2NtR4 NtTy is in close proximity to but do not overlap perfectly with GRASP-YFP, suggesting that the chimera accumulates in the Trans Golgi Network (TGN) recently defined with TgGalNac marker (51). These results are in agreement with the previously reported localization for TgROM2 (24) and provide the first evidence that R2Nt is sufficient to confer Golgi localization to related ROM proteins that are normally targeted to the micronemes or to the PM. In order to identify a sorting motif within R2Nt independently of the rest of the protein, the R2NtR21TMGFPTy fusion was constructed (Figureļ¾ 7)."
  • Microscopy type: Light
  • Microscopy method: Ty tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Golgi and TGN and PM during tachyzoite
  • Other genes localised in this publication: rhomboid-like protease 4, rhomboid family domain-containing protein, microneme protein MIC4

Dowse, T. J., Pascall, J. C., Brown, K. D., Soldati, D.
Apicomplexan rhomboids have a potential role in microneme protein cleavage during host cell invasion. (2005 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

golgi apparatus and not microneme during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13774

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_063290 rhomboid-like protease TgROM2
MANIRTLSDYASSPPRGSSALEGEGRQGGSPLPLFFPSGTQSGENVSWIQWLCPGIHLKSPIIIISFVQIAVYIASLAAG
LAPNEILAPTPQTLVMFGANIPELIRVGEIWRLICPLFLHLNLFHILMNLWVQIRIGLTIEEKYGWKMLLAVYFGVGVLA
NMISAAVLFCGQMKAGASTAVFALIGVQLAELALIWHAIQDRNSAIISVCICLFFVFVSSFGSQMDSVGHIGGLVMGFAA
GIWLNENSDIKPTWYDRARLTSQVALAAAPILSCIFIFLVPRC

Gene-Specific Links for TGME49_063290

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins