ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_063090 ()

14-3-3 protein, putative, a gene from Toxoplasma gondii

Compiled localisation
cytosol and parasite plasma membrane during extracellular tachyzoite

Who localised this protein by microscopy?

Assossou, O., Besson, F., Rouault, J. P., Persat, F., Brisson, C., Duret, L., Ferrandiz, J., Mayencon, M., Peyron, F., Picot, S.
Subcellular localization of 14-3-3 proteins in Toxoplasma gondii tachyzoites and evidence for a lipid raft-associated form. (2003 Jul 29, FEMS Microbiol Lett) PubMed / full text
   more detail about this publication

cytosol and parasite plasma membrane during extracellular tachyzoite
  • "Detection by immunofluorescence microscopy showed that 14-3-3 protein is cytosolic since it could be detected in permeabilized parasites, along with the cytosolic GRA1 protein. 14-3-3 protein is also membrane-associated, as evidenced by its colocalization with SAG1 protein in non-permeabilized parasites."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from NCU31542, annotation matches
  • Localisation record: cytosol and membrane during free tachyzoite
  • Comment: Called 14-3-3, but openoffice calc seems to convert it to date format all the time, messing this up
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10210

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_063090 14-3-3 protein, putative
MVSTDIAFSSAKKSTRRPLLVFHRPARDFFVFLRFPSFFSGHFPSFPLLLSCVPVSTMAEEIKNLRDEYVYKAKLAEQAE
RYDEMAEAMKNLVENCLDEQQPKDELSVEERNLLSVAYKNAVGARRASWRIISSVEQKELSKQHMQNKALAAEYRQKVEE
ELNKICHDILQLLTDKLIPKTSDSESKVFYYKMKGDYYRYISEFSGEEGKKQAADQAQESYQKATETAEAELPSTHPIRL
GLALNYSVFFYEILNLPQQACEMAKRAFDDAITEFDNVSEDSYKDSTLIMQLLRDNLTLWTSDLQADQQQQEGGEKPAEQ
ADQ

Gene-Specific Links for TGME49_063090

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins