ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_062730 (ROP16)

Rhoptry kinase family protein ROP16, a gene from Toxoplasma gondii

Compiled localisation
rhoptry during tachyzoite

Who localised this protein by microscopy?

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114859

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_025120 Rhoptry kinase family protein ROP16, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_062730 Rhoptry kinase family protein ROP16
MKVTTKGLAFALALLFCTRCATARYMSFEEAQKASEAAKRQIATLPSPDSTLSNPGSKHRNRGGSPAAGQPSQSTLQPEQ
AAAEVGLGAGGSTQGQGRTGGSAGAREERRSPSPQSAYPATSSASLRGYQTQLSPSHLPPRSSGPGGWFPTESIFTPWSS
PPQPLTQRKPSLSGVVVTEFQEPQEQYGAASSLASSPKRYVSGASSSALSGKAVPTPASLGQENPLFPVQSATLDSGIQS
PAQERRGSPQRQIAMSTENPADSGASQLASSVSSYVAVQTPHVKRSERIRRVRLSEEGLEEVQQLKAAAAQLLVAVPDYE
AMRAVLQEAVLSEQRVATRKRKRKQPPGAVESAVDEVFPPNERVMMINANGVPIALYNRGHLGSGHFGAVIKASLDDGTL
YAAKVPYSQIVPNADATSAELEAEISSARAELVKTIRQELDVRDKLVAKGLTLTETAEQYGLPLCQMTLTLPENKATVVR
RGSRLVVVSKEVMLLPLIDGSPSNSLVQSQPPFLFQRAVAREAIIALAKLHELGFAHGDVKLNNMMIDVHGFGHMLDMGS
VRPVDSCVSEEDKYYLRLWAPELAKSQHTSQQTCLKRGALDVWALGLAIFEFVCFNRLPYSLSNLPSSLWSRVEHLSRLR
LSDFSAKDCNESDPAVMGIVAQFLNPNPEERPELPKFVSSYTFFRQAPGVTSHLTRIPTTELSSHRM

Gene-Specific Links for TGME49_062730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins