ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_062720 ()

eukaryotic translation initiation factor 1A, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10574

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0447 translation initiation factor eIF-1A, putative
  • PBANKA_090560 translation initiation factor eIF-1A, putative
  • PY01973 eukaryotic translation initiation factor 1a
  • PVX_092775 translation initiation factor eIF-1A, putative
  • PCHAS_070680 translation initiation factor eIF-1A, putative
  • PKH_094090 translation initiation factor eIF-1A, putative
  • TGME49_062720 eukaryotic translation initiation factor 1A, putative
  • NCLIV_025130 Translation initiation factor 1A (AeIF-1A), related
  • cgd8_3330 conserved hypothetical protein
  • Chro.80386 translation initiation factor eIF-1A
  • CMU_023890 translation initiation factor eIF-1A, putative
  • TP02_0767 translation initiation factor eIF-1A, putative
  • TA14970 translation initiation factor eif-1A, putative
  • BBOV_III011550 translation initiation factor eIF-1A, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_062720 eukaryotic translation initiation factor 1A, putative
MPKNKGKGGKNRRRGKNDNEGEKRELQYKEDGQEYGQVLRMLGNGRLEAYCFDGVKRLCHIRGKMRKRVWVNSGDIVLVS
LRDFQNDKGDVIAKYNPDEARLLKQYGELPANAKINESDVFGDEDGGGGGIDFQDDSDVSDESSDEEDGKKEEMDIDDI

Gene-Specific Links for TGME49_062720

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins