ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_062150 ()

kelch motif domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14180

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0238 kelch protein, putative
  • PBANKA_135670 conserved Plasmodium protein, unknown function
  • PY02946 unnamed protein product, putative
  • PVX_083080 kelch domain-containing protein
  • PCHAS_136130 conserved Plasmodium protein, unknown function
  • PKH_121080 kelch motif containing protein, putative
  • TGME49_062150 kelch motif domain-containing protein
  • NCLIV_025480 kelch motif domain-containing protein, putative
  • cgd7_2610 POZ+kelch domain protein with kelch repeats at the C-terminus
  • Chro.70297 hypothetical protein
  • CMU_034700 kelch motif family protein
  • TP01_0488 hypothetical protein, conserved
  • TA20610 conserved protein with kelch domain, putative
  • BBOV_I003590 kelch repeat and K+ channel tetramerisation domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_062150 kelch motif domain-containing protein
MNSEVCSRFSFPSPQASASCAALSSFDKKLPPIAADSPGLDHARPTLDTLRYLGAGGVSSETGRLEPEAVGNLPRAFART
RPGLTTGTTLSSGSSAFSVPLYSDPSCLPLPLKGKSFSPLAAMNSTGNASPSSLLRRGSADDALAYPPGTSASALGGSSR
SPMEAGFCPPAPGPAVGTGVGGLLYSATASPEFLCSSTAGGPCPAASAGFLSSRVLANGGLSRLSSRPFDASCATLPRLS
GAPTGDGAGALHALHALHAPVLAEKREPGPAEFLDGDRGGEERMHPRAASGDTEEGHAAPFASAEDFETMVGDLRRTFIG
WLKKTESDLRKEKRDLVRAKKEFEEERKQAREKLQQEKKIEYEKIKEERRKAQAEMATQIKQIQVEREDARRKLNAERGR
FEEEKEAHRRRTLLEKERFRQEAEALDAEKRRIVDANIATETVVDLNVGGVVFEASRHTFVQQPGSFLETLLSGRHHVSR
DKQGRIFLDRDSELFRIILNFLRNPAMPPQPRDSAESDAITQEADFLGIRFFPFPLVFAVGGHNGVEHLRSLEVLDIGQQ
CWRPCKAMQTERAYFGSSVFQNRLFVYGGQNLDYKALCETEVFDALRDVWMTGAALNVPRRNTCGTFMGARHFAIGGFDG
SDILSSVECYDPRMKNWMQVAPLTTPRSSAMCCVRDDHLYVLGGTNGERLRTVEMYDHRMNKWEVLPSEMIEVRSAGSAA
CSFGHIVAMGGIDNSNVVHSSVEVLDPQTQRWSFLTNMATPRMDCAAVVVSDSILVTGGQSEDVLSSTAFLRQEVNEWQE
GPPMISPRYGHGILLANL

Gene-Specific Links for TGME49_062150

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins