ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_062010 (CAM2)

calmodulin, putative, a gene from Toxoplasma gondii

Compiled localisation
conoid and daughter inner membrane complex and mother inner membrane complex during tachyzoite

Who localised this protein by microscopy?

Hu, K., Johnson, J., Florens, L., Fraunholz, M., Suravajjala, S., DiLullo, C., Yates, J., Roos, D. S., Murray, J. M.
Cytoskeletal components of an invasion machine--the apical complex of Toxoplasma gondii. (2006 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

conoid and daughter inner membrane complex and mother inner membrane complex during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114875

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_062010 calmodulin, putative
MANNLESIFKVFDSDGDGKLTCIEMHQALGASGCSPSVEEVQEAVKEKGSDTGDLEQFKALYAAYANKKVTASELVPLFS
VVDPAKKGVVDVRSLNYLLTNFNERLTQAEAEEFIQGMLGLPKEGTVPIPDVAQKVEQLQKV

Gene-Specific Links for TGME49_062010

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins