ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061980 (GRASP, GRASP55)

gorasp2-prov protein, a gene from Toxoplasma gondii

Compiled localisation
golgi apparatus during early tachyzoite cell division and intracellular tachyzoite and tachyzoite cell division and tachyzoite

Who localised this protein by microscopy?

Agop-Nersesian, C., Egarter, S., Langsley, G., Foth, B. J., Ferguson, D. J., Meissner, M.
Biogenesis of the inner membrane complex is dependent on vesicular transport by the alveolate specific GTPase Rab11B. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

golgi apparatus during early tachyzoite cell division and tachyzoite cell division
  • "We confirmed that in resting parasites the observed accumulation of Rab11B close to the nucleus corresponds to the single Golgi-stack [13], [12] as demonstrated by co-localisation with the Golgi-marker GRASP-RFP [27],"
  • Microscopy type: light
  • Microscopy method: RFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi during initial stage of cell division and endodyogeny
  • Other genes localised in this publication: Rab 11b, putative, membrane skeletal protein IMC1

Sheiner, L., Santos, J. M., Klages, N., Parussini, F., Jemmely, N., Friedrich, N., Ward, G. E., Soldati-Favre, D.
Toxoplasma gondii transmembrane microneme proteins and their modular design. (2010 Jun 9, Mol Microbiol) PubMed / full text
   more detail about this publication

golgi apparatus during intracellular tachyzoite
  • "Anti-GRA3 or GRASP-YFP were used as dense granules and Golgi markers respectively. "
  • Microscopy type: fixed light
  • Microscopy method: YFP tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Golgi during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein, microneme protein MIC4, dense granule protein 3

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

golgi apparatus during tachyzoite

Nishi, M., Hu, K., Murray, J. M., Roos, D. S.
Organellar dynamics during the cell cycle of Toxoplasma gondii. (2008 May 1, J Cell Sci) PubMed / full text
   more detail about this publication

golgi apparatus during intracellular tachyzoite

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

golgi apparatus during intracellular tachyzoite

Hartmann, J., Hu, K., He, C. Y., Pelletier, L., Roos, D. S., Warren, G.
Golgi and centrosome cycles in Toxoplasma gondii. (2006 Jan, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

golgi apparatus during tachyzoite
  • "Transient expression of GRASP55-mRFP (24 h post-transfection) shows co-localization with stably-expressed GRASP55-YFP [10]. Co-localization was observed throughout the cell cycle"
  • Microscopy type: Light
  • Microscopy method: mRFP tag, YFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi during tachyzoite
  • Other genes localised in this publication: caltractin (centrin), putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11551

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_061980 gorasp2-prov protein
MGAASSLDQRGTLAVGEKARGGAYRVVKVQRGSPAEEAGLEVFFDFITRIDDLPLTSPNEETLQAFFAKVNRSTRPEPVQ
LIVFNARMRGFRNVTLRPAVLSHAQRPAASCVFSLGLSVSFSDVGNVMSEGVRVLSVAPNSPAAHAGLVELEDWILADSQ
GVFRDVDDLVDSVAAALNRHLQIFVFNSSTERIREVMVVPNNAWGGEGSLGCKLGSGYLHRLPFSRRVRVTEAGAKGEES
LAPQAPSAADADSSEPAPSGASDAVGSVAVGSAAAAQARSSTQSESVGHSVSPGEAVSAGRGNAAQSEAREEAFRVQKEE
GKQATGDREDKEIYILDSDGAPVLLTPSIEFESAYPPYAHALEEEDVWSVGAAEDSDFPACPDELDRPNFEFQTRNYCLY
PVTNSPLKEALPLCSDREVRQGDSDRGSDGASPAAYASPYFAYDFPYAAAMARHTSAVFTGPPRPGEVVSIPSLH

Gene-Specific Links for TGME49_061980

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins