ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061950 (ATP-B)

ATP synthase beta chain, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during tachyzoite

Who localised this protein by microscopy?

Lin, S. S., Gross, U., Bohne, W.
Type II NADH dehydrogenase inhibitor 1-hydroxy-2-dodecyl-4(1H)quinolone leads to collapse of mitochondrial inner-membrane potential and ATP depletion in Toxoplasma gondii. (2009 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite
  • "Mitochondrial localization of myc-tagged ATPase-β was confirmed by colocalization with Mitotracker fluorescence."
  • Microscopy type: Light
  • Microscopy method: myc tag
  • Strain: RH
  • Gene model mapping comments: blast from DQ228960, annotation matches
  • Localisation record: mitochondrion during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10551

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFL1725w ATP synthase beta chain, mitochondrial precursor, putative
  • PBANKA_145030 ATP synthase beta chain, mitochondrial precursor, putative
  • PY00963 ATP synthase F1, beta subunit
  • PVX_100735 ATP synthase beta chain, mitochondrial precursor, putative
  • PCHAS_145260 ATP synthase beta chain, mitochondrial precursor, putative
  • PKH_145430 ATP synthase beta chain, mitochondrial, putative
  • NCLIV_025670 ATP synthase subunit beta (EC 3.6.3.14), related
  • cgd2_1360 ATP synthase beta chain, mitochondrial precursor, putative
  • Chro.20148 ATP synthase beta chain, mitochondrial precursor
  • CMU_008950 ATP synthase F1, beta subunit, putative
  • TP01_0389 ATP synthase F1, beta chain, putative
  • TA20945 ATP synthase beta chain, mitochondrial precursor, putative
  • BBOV_IV005830 ATP synthase F1 beta chain, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_061950 ATP synthase beta chain, putative
MASPALQTCWRNLARLSGAQVRPSHFGAFSLGSRMSPFSSLLGARASPIATGRAGLRFLSSAAPNPGKKPASAAPPAGTN
HGRITQVIGAVVDVHFDEQLPPILNSLEVQGHTNRLVLEVAQHLGENTVRTIAMDATEGLVRGQKVVDTGAPIQVPVGVE
TLGRIMNVIGEPVDECGPVPAKKTYSIHRAAPLFADQSTEPGLLQTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMEL
INNVANKHGGFSVFAGVGERTREGNDLYHEMMTTGVIKRKKLEDGKFDFTGSKAALVYGQMNEPPGARARVALTALSVAE
YFRDEQGQDVLLFIDNIYRFTQAGSEVSALLGRIPSAVGYQPTLATDLGQLQERITTTKKGSITSVQAVYVPADDLTDPA
PATTFAHLDATTVLSRQIAELGIYPAVDPLDSTSRMLAPEIVGQEHYDTARATQKLLQDYKSLQDIIAILGMDELSEEDK
LVVSRARKIQRFLSQPFTVAEVFTGKPGRFVELPETIKSAQTILRGECDDLPEMAFYMCGGLEEVRSKAVKMAQEAASGK

Gene-Specific Links for TGME49_061950

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins