ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061780 (MIC7)

microneme protein 7, a gene from Toxoplasma gondii

Compiled localisation
microneme
during not tachyzoite

Who localised this protein by microscopy?

Meissner, M., Reiss, M., Viebig, N., Carruthers, V. B., Toursel, C., Tomavo, S., Ajioka, J. W., Soldati, D.
A family of transmembrane microneme proteins of Toxoplasma gondii contain EGF-like domains and function as escorters. (2002 Feb 1, J Cell Sci) PubMed / full text
   more detail about this publication

microneme, during not tachyzoite
  • "MIC7Ty colocalized (-Ty, red) with the microneme marker TgMIC3 (green)."
  • Microscopy type: Light
  • Microscopy method: Ty tag
  • Strain: RH
  • Gene model mapping comments: Blast from AF357911, annotation matches
  • Localisation record: microneme
  • Comment: under TUB1 constitutive promoter
  • Other genes localised in this publication: microneme protein MIC3, microneme protein MIC6, microneme protein 8
  • "As expected from the RT-PCR results, both proteins are poorly or not expressed in tachyzoites of the Prugniaud (Fig. 7A) or RH (data not shown) strains."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH, Prugniaud
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during tachyzoite
  • Other genes localised in this publication: microneme protein MIC3, microneme protein MIC6, microneme protein 8

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114879

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_061780 microneme protein 7
MGGWESKDACESGGTAFCGTVANSAGCIALSKEFYCTCLPGFQPEGRRMNSSCVDIDECARGIGLCFSKIENSECVNTPG
SFECRCNEYRTLKNNVCEDINECLDNRGGCAEHTDCINNDGAAVTCRCLPGYTGNDGKPGRACKDINECEEPDHCPENSV
CVNTPGSYRCECKTGFAKDAEGMCTGKDFCVTGENGCDPNFATCTPVVGSYACACKDGFQGSGRKGECKPLPGSEYKACE
LLGLHCGRYQGCASDNAGSYRCAALTKVQQVKVLLSEGPGTETPLWLWCCVALAAVIFVGAVVYGVRYFLKKWKKTNESE
DDALLRYGYDYGAAHSFRG

Gene-Specific Links for TGME49_061780

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins