ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061540 ()

DNA-directed RNA polymerases I and III subunit RPAC2, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11841

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0150 DNA-directed RNA polymerase I/III subunit, putative
  • PBANKA_102750 RNA polymerase small subunit, putative
  • PY04455 RNA polymerases L / 13 to 16 kDa subunit
  • PVX_085690 RNA polymerase small subunit, putative
  • PCHAS_102830 RNA polymerase small subunit, putative
  • PKH_133200 RNA polymerase small subunit, putative
  • TGME49_061540 DNA-directed RNA polymerases I and III subunit RPAC2, putative
  • NCLIV_025940 DNA-directed RNA polymerase I 16 kDa polypeptide, related
  • CMU_018340 DNA-directed RNA polymerases I and III subunit RPAC2, putative
  • TA08625 RNA polymerases I and III subunit (RPC19 homologue), putative
  • BBOV_II001150 RNA polymerase small subunit protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_061540 DNA-directed RNA polymerases I and III subunit RPAC2, putative
MADDGAGGSSCGASSSPSGKAWTAGVHEQEACKASQLTFTLTGEDHTLGNTIRSILVRKPGVEFAGYSVPHPTQPEMNIR
LQTTGESAMQLLRESFDDLASICDHLDTLYDEALEDFMKKQGESSEMTS

Gene-Specific Links for TGME49_061540

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins