ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061460 ()

structure specific recognition protein I, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11464

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0393 structure specific recognition protein, putative
  • PBANKA_130530 structure specific recognition protein, putative
  • PY06012 putative structure specific recognition protein
  • PVX_118420 structure specific recognition protein, putative
  • PCHAS_130850 structure specific recognition protein, putative
  • PKH_126490 structure specific recognition protein, putative
  • TGME49_061460 structure specific recognition protein I, putative
  • NCLIV_026040 structure specific recognition protein I, putative
  • cgd7_5280 structure-specific recognition protein 1 (SSRP1) (recombination signal sequence recognition protein)
  • Chro.70588 structure specific recognition protein
  • CMU_019430 FACT complex subunit SSRP1, putative
  • TA09185 structure-specific recognition protein (SSRP) 1, putative
  • BBOV_III003170 structure specific recognition protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_061460 structure specific recognition protein I, putative
MAETADAPAAAPLPASAPPGGSAGPAIALGNIRGFGRNDIGLFKMSGDLFGWKNRKTGSVHQYKAADIVSASWIMTGFDA
YQLRILLGPHKNDLMVRFDGFHEKNFADLSRHFDAHFKVKLQRGQQAYRGWHWGDVKMEGNNLQLTVDGCAAFDIHAQEI
AQVTTPSKNDLAIELIQDDTRDQQEDQLLEVRFYQPFAGDDDAEGPLQQLKQKLVKKSGVAETKMDSVALLNDVPLLVPR
GRYEIDIGRRALKFHGKSYDYTIQYSSINRMFLVPRPNSPHVNFILSLENAMRQGQTSYPFVVMQFDSESVHSVDVNLEP
AELQQRGLEKLIEGKTFHVVTRLFRALVGKSVIVPGDFKSVKQQFGIACSYRAQSGHLYPLNRSFLFIVKPVIFIRYDDV
VSVEFSRTGASTTNRFFAFTVSVRGGGEYEFTSIDRNEYKPLVDFLMEKGIRIKNMETPEPSRGGALEAADLPSDDEDDD
DYDEDDSDSEDEDFQEDDEDDNASESPSEEEEEDSKESKKRKKKEKKSKKEKKRKKERD

Gene-Specific Links for TGME49_061460

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins