ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061240 (H3)

histone H3, a gene from Toxoplasma gondii

Compiled localisation
nucleus during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Brooks, C. F., Francia, M. E., Gissot, M., Croken, M. M., Kim, K., Striepen, B.
Toxoplasma gondii sequesters centromeres to a specific nuclear region throughout the cell cycle. (2011 Mar 1, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

nucleus during tachyzoite
  • "As expected, histones H3 and H3.3 label the entire nucleus"
  • Microscopy type: fixed light
  • Microscopy method: antibody to YFP tag
  • Strain: RH
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nucleus during tachyzoite
  • Other genes localised in this publication: histone H3 variant, putative, histone H3.3 variant

Gissot, M., Kelly, K. A., Ajioka, J. W., Greally, J. M., Kim, K.
Epigenomic modifications predict active promoters and gene structure in Toxoplasma gondii. (2007 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

nucleus during intracellular tachyzoite
  • "Commercial antibodies (FITC; green) specific for histone modifications H3K4me3 (SF2A), H3K9ac (SF2B), and H4ac (SF2C) label the nucleus of the parasite (DAPI; blue)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: Blast from AAO23911, annotation matches
  • Localisation record: Nucleus during intracellular tachyzoite
  • Other genes localised in this publication: histone H4, putative

Saksouk, N., Bhatti, M. M., Kieffer, S., Smith, A. T., Musset, K., Garin, J., Sullivan, W. J. Jr, Cesbron-Delauw, M. F., Hakimi, M. A.
Histone-modifying complexes regulate gene expression pertinent to the differentiation of the protozoan parasite Toxoplasma gondii. (2005 Dec, Mol Cell Biol) PubMed / full text
   more detail about this publication

nucleus during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10036

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_061240 histone H3
MARTKQTARKSTGGKAPRKQLASKAARKSAPMSGGIKKPHRYRPGTVALREIRRYQKSTDLLIRKLPFQRLVREIAQDFK
TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERS

Gene-Specific Links for TGME49_061240

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins