ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061070 (PT, APT1, APT)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
apicoplast and reticular staining outside apicoplast during intracellular tachyzoite
apicoplast membrane during tachyzoite
cytoplasmic vesicle during tachyzoite

Who localised this protein by microscopy?

Brooks, C. F., Johnsen, H., van Dooren, G. G., Muthalagi, M., Lin, S. S., Bohne, W., Fischer, K., Striepen, B.
The toxoplasma apicoplast phosphate translocator links cytosolic and apicoplast metabolism and is essential for parasite survival. (2010 Jan 21, Cell Host Microbe) PubMed / full text
   more detail about this publication

apicoplast membrane during tachyzoite
  • "This might be due to poor destruction of multipass membrane proteins or to the fact that TgAPT localizing to the inner membranes of the apicoplast might be protected from proteasomal degradation."
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast membrane during tachyzoite
  • Other genes localised in this publication: -

Karnataki, A., Derocher, A., Coppens, I., Nash, C., Feagin, J. E., Parsons, M.
Cell cycle-regulated vesicular trafficking of Toxoplasma APT1, a protein localized to multiple apicoplast membranes. (2007 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast membrane and cytoplasmic vesicle during tachyzoite
  • "This translocator, TgAPT1, when tagged with HA, localized to multiple apicoplast membranes in T. gondii.... Localization of TgAPT1 to multiple apicoplast membranes and vesicles"
  • Microscopy type: Light, EM
  • Microscopy method: HA tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: When taken directly from 17367386, you get 53.m10326, which does not appear to be a gene in the toxodb? Orthomcl from the falciparum APT1 says 55.m10326. RACE suggests the predicted start site is actually correct, which is strange because it means there isn't a signal peptide or transit peptide
  • Localisation record: apicoplast membrane and cytoplasmic vesicles during tachyzoite
  • Other genes localised in this publication: membrane skeletal protein IMC1

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast and reticular staining outside apicoplast during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11470

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_110790 triose phosphate transporter, putative
  • PY00389 Arabidopsis thaliana At5g54800/MBG8_6-related
  • PVX_097975 triose/hexose phosphate phosphate translocator, putative
  • PCHAS_110760 triose phosphate transporter, putative
  • PKH_102460 triose or hexose phosphate/phosphate translocator, putative
  • NCLIV_026210 hypothetical protein
  • TA05100 glucose-6-phosphate/phosphate translocator, putative
  • BBOV_I004950 triose or hexose phosphate/phosphate translocator, putative
  • BBOV_I004960 triose phosphate/phosphate translocator, putative
  • BBOV_I004970 triose or hexose phosphate/phosphate translocator, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_061070 hypothetical protein
MEESKRLGVSALPPQYGTVSTGGARPAKDLESQASPASGDQTAFYAQLGVMLLFWYALNVMYNLDNKLALIMLPLPWTVS
TFQLFFGWLFFGFAWATGLRPVPRIHTTELFVTRIAPQGLCHFFVHIGAVISMGCGAVSFTHIVKASEPVLTALLSGLAL
HQVFSWQTYLSLVPIVAGVIMASVTELSFTWKAFGCALVSALGSSARAVFAKLAMADRKQVGENLSSANMYALLTIVASL
VSLPPAIFAEGAKVAAVWEACTGPDSPWTGQQIIAKLCFSGLWYYMYNEVAYLCLEKINQVTHAVANTLKRVVIIVASVL
FFQTPVTALGATGSFVAIAGTLIYSLSKTKYG

Gene-Specific Links for TGME49_061070

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins