ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061050 ()

mitotic control protein dis3, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10514

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.289 mitotic control protein dis3 homologue, putative
  • PBANKA_113560 mitotic control protein dis3 homologue, putative
  • PY02885 hypothetical protein
  • PY06658 probable mitotic control protein dis3
  • PVX_114935 hypothetical protein, conserved
  • PCHAS_113510 mitotic control protein dis3 homologue, putative
  • PKH_111150 mitotic control protein dis3 homologue, putative
  • TGME49_061050 mitotic control protein dis3, putative
  • NCLIV_026230 DIS3-like exonuclease 1 (EC 3.1.13.-), related
  • cgd2_2090 mitotic control protein dis3, putative
  • Chro.20227 mitotic control protein dis3
  • CMU_036960 exosome complex exonuclease RRP44, putative
  • TP01_0496 mitotic control protein dis3, putative
  • TA20585 exosome complex exonuclease rrp44, putative
  • BBOV_I003540 RNB-like domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_061050 mitotic control protein dis3, putative
MAYSLLPGSTARRLAGEATDQAECEGKEGRRREREDEGEMELDFCEEGVSHANRRLLTFLKATRRGKIQKVVREIYLRDD
LPCGIAGCCLCYDPSDETERKGLLSIDERILLLDTNVALRQLDFLQEDPCINNCLLLSSVLSEVRRRNLQTYSALLSLCR
QSADSSSGTRKPGVGASSRGDRESERAEKRFTAFANDVFRATFVDREEEETLEARDRRSLFAAARWFSDHLLAAGAALGL
DASHLGRVTILTDEKKRKIEAEQRGLEALTLREFVEEMRARYPTAGEKLAQLEDEGEDEPAVADGEGALGQRRTEGTAKR
RKTAFYDAHLREEEITRQLKTGKLLKGKLRMAPTCSWRGVVLLSGGREVKIRGKKNLNRAVEGDVVAVELLARADQLKSE
KEQTEEREEERREPSAKSPEEAETRVINEKAVAAGNFMRESEQDIQEIEDDARVFPTAEMTDDELGPEDADDEEMEGKVV
GIIRKNAREFCGTIRPFDNPFRTETATSGLPTEVVFIPADPRIPNIILKTRQYEQLLNKRIVAVIDSWDRFSRNPRGHWT
EILGEFGSAEAEANVILREQVDPPGCKDIDDALSLEVLENGNYRVGVHIADVTYFLKEGTALDEEASERCTTVYLVERRT
DMLPSLLTTDLCSLVGNQDRLAFSVLWEMTPEGDIVSSSFHKTFIHSRAALTYAEAQNMIDDPNDKSELAENLRRLLAIS
KVIRRKRTEAGALQLASPDVQIIRDTLKDNRDDKTQPPVKPTETRRGDITSEKNENGEKGERAKECYAEEVVQEEASDIA
LYQARETNRMVEDFMLLANTTVAEKIVSYFPSASLLRRHPDPKEKQLEALKELLKSRGIENFEFSSSKRLAASLNAVAKA
APELDFLVRILTTRCMNQAVYFSSGDILSNAHSAKQSLTAALSSSSSSVDISPYFHHYGLAAPLYTHFTSPIRRYADVVV
HRMLAAAIGIAEVPRVCRNKQQLSQQCELLNVKHRNAQIAGRNSVQYHVYMYFKNKGAKEAVGTVTKVKKNGAMVYVHKY
GLEGVVFFNEREYSFDADEQHLVNRSSGETVQIFDALLVRIEAEQSNDFRPSVAMKLIRKATDQERA

Gene-Specific Links for TGME49_061050

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins